CD1C recombinant protein

CD1C Recombinant Protein

Cat. Num. AAA3003522

• Gene Names: CD1C; R7; CD1; CD1A; BDCA1
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD1C; CD1C Recombinant Protein; CD1C recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHFSM

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 867
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD1C recombinant protein

Background: The CD1 multigene family encodes five forms of the CD1 T-cell surface glycoprotein in human, designated CD1A, 1B, 1C, 1D and 1E. CD1, a type 1 membrane protein, has structural similarity to the MHC class I antigen and has been shown to present lipid antigens for recognition by T lymphocytes. CD1 antigens are associated with beta-2-Microglobulin and expressed on cortical thymocytes, Langerhans cells, a B cell subset and some dendritic cells. Specifically, CD1A is a marker for Langerhans cell histiocytosis (LCH) and is found on interdigitating cells. Adaptor-protein complexes and CD1-associated chaperones control CD1 trafficking, and the development and activation of CD1-restricted T cells. Constitutive endocytosis of CD1B molecules and the differential sorting of MHC class II from lysosomes separate peptide- and lipid antigen-presenting molecules during dendritic cell maturation. CD1B is also expressed in interdigitating cells. The human CD1 genes are all closely linked in a cluster mapping at chromosome 1q23.1.

NCBI and Uniprot Product Information

• NCBI GI #: 110618227
• NCBI GeneID: 911
• NCBI Accession #: NP_001756.2
• NCBI GenBank Nucleotide #: NM_001765.2
• UniProt Accession #: P29017; Q5TDJ7; Q6IAS4; Q9UMM0; Q9UN96
• Molecular Weight: 37,654 Da
• NCBI Official Full Name: T-cell surface glycoprotein CD1c
• NCBI Official Synonym Full Names: CD1c molecule
• NCBI Official Symbol: CD1C
• NCBI Official Synonym Symbols: R7; CD1; CD1A; BDCA1
• NCBI Protein Information: T-cell surface glycoprotein CD1c; CD1C antigen, c polypeptide; cortical thymocyte antigen CD1C; differentiation antigen CD1-alpha-3
• UniProt Protein Name: T-cell surface glycoprotein CD1c
• Protein Family: T-cell surface glycoprotein
• UniProt Gene Name: CD1C
• UniProt Entry Name: CD1C_HUMAN