Monocyte differentiation antigen CD14 (Cd14) Recombinant Protein | Cd14 recombinant protein

Recombinant Mouse Monocyte differentiation antigen CD14 (Cd14)

Cat. Num. AAA968207

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Monocyte differentiation antigen CD14 (Cd14); Recombinant Mouse Monocyte differentiation antigen CD14 (Cd14); Cd14 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 16-336, Full length protein
• Sequence: SPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFN
• Sequence Length: 321

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Cd14 recombinant protein

CD14 is a surface protein preferentially expressed on monocytes
macrophages. It binds lipopolysaccharide binding protein and recently has been shown to bind apoptotic cells. Alternative splicing results in multiple transcript variants encoding the same isoform.

NCBI and Uniprot Product Information

• NCBI GI #: 6753332
• NCBI GeneID: 12475
• NCBI Accession #: NP_033971.1
• NCBI GenBank Nucleotide #: NM_009841.4
• UniProt Accession #: P10810
• Molecular Weight: 39,204 Da
• NCBI Official Full Name: monocyte differentiation antigen CD14
• NCBI Official Synonym Full Names: CD14 antigen
• NCBI Official Symbol: Cd14
• NCBI Protein Information: monocyte differentiation antigen CD14
• UniProt Protein Name: Monocyte differentiation antigen CD14
• Protein Family: Monocyte differentiation antigen
• UniProt Gene Name: Cd14

NCBI Description

This gene encodes a protein that plays an important role in the innate immune response and is expressed in monocyte/macrophage cells. This gene product acts as a co-receptor that binds several microbial and fungal molecules, including lipopolysaccharides (LPS). This proteins LPS-binding activity is enhanced by the LPS binding protein (LBP) to allow binding to the TLR4-MD-2 co-receptor complex. The product of this gene is found in two forms, either as a soluble protein or attached to the cell surface by a glycosylphosphatidylinositol anchor. [provided by RefSeq, Jul 2014]

Uniprot Description

Coreceptor for bacterial lipopolysaccharide. In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS) (PubMed:16148141). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (PubMed:8612135, PubMed:15895089). Acts as a coreceptor for TLR2:TLR6 heterodimer in response to diacylated lipopeptides and for TLR2:TLR1 heterodimer in response to triacylated lipopeptides, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway (). Acts as an accessory receptor for M.tuberculosis lipoproteins LprA, LprG and LpqH, in conjunction with coreceptors TLR2 and TLR1. The lipoproteins act as agonists to modulate antigen presenting cell functions in response to the pathogen (PubMed:19362712). Binds electronegative LDL (LDL-) and mediates the cytokine release induced by LDL- ().