Cytochrome c biogenesis protein ccs1 (ccs1) Recombinant Protein | ccs1 recombinant protein
Recombinant Guillardia theta Cytochrome c biogenesis protein ccs1 (ccs1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome c biogenesis protein ccs1 (ccs1); Recombinant Guillardia theta Cytochrome c biogenesis protein ccs1 (ccs1); ccs1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-414
Sequence
MNYIIKFLNKLNNLTVAIIILLAIALASALGTVIEQNKNTDFYLKNYPLTKPLFNFVTSDLILKFGLDHVYTSWWFIFLIILLLLSLTLCTITRQLPALKLARLWQFYTNFNTKAKFQIRFKTNSSSLTKLTYYLEEKNYKIKHFNHFVYAYKGIFGRVSPIIVHFSLVIVLIGSMLSTTQGRTQEAFIVVNQEKPVLDTYEAYVNDFKIAYNSQGLIDQFYSDLILETRQASKIQKTIYVNEPLNYSNITIYQTDWNIDNLVICIDNQNYYSIPLQFIELPNGSESKYWINRLDLFGQSVFCVVNDLTGIVYLYNQNKDLICISSLGEFITLNGHTITFNKLVASTGLQFKLDSFIPLVYLGFLLLMISTLLSYISYSQVWLVKNGSTTYIFGSTNRAKFAFIKQLTEIANQC
Sequence Length
414
Species
Guillardia theta (Cryptomonas phi)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for ccs1 recombinant protein
ccs1; ycf44
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,777 Da
NCBI Official Full Name
c-type cytochrome biogenensis protein
NCBI Official Symbol
ccs1
NCBI Protein Information
c-type cytochrome biogenensis protein
UniProt Protein Name
Cytochrome c biogenesis protein ccs1
Protein Family
UniProt Gene Name
ccs1
UniProt Synonym Gene Names
ycf44
UniProt Entry Name
CCS1_GUITH
Uniprot Description
Function: Required during biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) at the step of heme attachment
By similarity. HAMAP-Rule MF_01392
Subunit structure: May interact with ccsA
By similarity. HAMAP-Rule MF_01392
Subcellular location: Plastid › chloroplast thylakoid membrane; Multi-pass membrane protein
By similarity HAMAP-Rule MF_01392.
Sequence similarities: Belongs to the ccs1/ccsB family.
Similar Products
Product Notes
The ccs1 ccs1 (Catalog #AAA1118277) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-414. The amino acid sequence is listed below: MNYIIKFLNK LNNLTVAIII LLAIALASAL GTVIEQNKNT DFYLKNYPLT KPLFNFVTSD LILKFGLDHV YTSWWFIFLI ILLLLSLTLC TITRQLPALK LARLWQFYTN FNTKAKFQIR FKTNSSSLTK LTYYLEEKNY KIKHFNHFVY AYKGIFGRVS PIIVHFSLVI VLIGSMLSTT QGRTQEAFIV VNQEKPVLDT YEAYVNDFKI AYNSQGLIDQ FYSDLILETR QASKIQKTIY VNEPLNYSNI TIYQTDWNID NLVICIDNQN YYSIPLQFIE LPNGSESKYW INRLDLFGQS VFCVVNDLTG IVYLYNQNKD LICISSLGEF ITLNGHTITF NKLVASTGLQ FKLDSFIPLV YLGFLLLMIS TLLSYISYSQ VWLVKNGSTT YIFGSTNRAK FAFIKQLTEI ANQC. It is sometimes possible for the material contained within the vial of "Cytochrome c biogenesis protein ccs1 (ccs1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
