Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

C-C chemokine receptor type 6 (Ccr6) Recombinant Protein | Ccr6 recombinant protein

Recombinant Mouse C-C chemokine receptor type 6 (Ccr6)

Gene Names
Ccr6; CCR-6; KY411; Cmkbr6; CC-CKR-6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-C chemokine receptor type 6 (Ccr6); Recombinant Mouse C-C chemokine receptor type 6 (Ccr6); Recombinant C-C chemokine receptor type 6 (Ccr6); C-C chemokine receptor type 6; C-C CKR-6; CC-CKR-6; CCR-6; KY411 CD_antigen= CD196; Ccr6 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-111; Partial
Sequence
MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAYSLICVFGLLGNIMVVMTFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATNTWVFSDALCK
Sequence Length
111
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,103 Da
NCBI Official Full Name
C-C chemokine receptor type 6 isoform A
NCBI Official Synonym Full Names
chemokine (C-C motif) receptor 6
NCBI Official Symbol
Ccr6
NCBI Official Synonym Symbols
CCR-6; KY411; Cmkbr6; CC-CKR-6
NCBI Protein Information
C-C chemokine receptor type 6
UniProt Protein Name
C-C chemokine receptor type 6
Protein Family
UniProt Gene Name
Ccr6
UniProt Synonym Gene Names
Cmkbr6; C-C CKR-6; CC-CKR-6; CCR-6
UniProt Entry Name
CCR6_MOUSE

Uniprot Description

CCR6: Receptor for a C-C type chemokine. Binds to MIP-3- alpha/LARC and subsequently transduces a signal by increasing the intracellular calcium ions level. Belongs to the G-protein coupled receptor 1 family.

Protein type: Motility/polarity/chemotaxis; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1; Membrane protein, integral

Cellular Component: cell surface; membrane; integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; signal transducer activity; protein binding; C-C chemokine receptor activity; chemokine receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration; immune response; signal transduction; chemotaxis

Research Articles on Ccr6

Similar Products

Product Notes

The Ccr6 ccr6 (Catalog #AAA1211323) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-111; Partial. The amino acid sequence is listed below: MNSTESYFGT DDYDNTEYYS IPPDHGPCSL EEVRNFTKVF VPIAYSLICV FGLLGNIMVV MTFAFYKKAR SMTDVYLLNM AITDILFVLT LPFWAVTHAT NTWVFSDALC K . It is sometimes possible for the material contained within the vial of "C-C chemokine receptor type 6 (Ccr6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.