Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

C-C chemokine receptor type 5 (Ccr5) Recombinant Protein | Ccr5 recombinant protein

Recombinant Rat C-C chemokine receptor type 5 (Ccr5)

Gene Names
Ccr5; Ckr5; Cmkbr5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-C chemokine receptor type 5 (Ccr5); Recombinant Rat C-C chemokine receptor type 5 (Ccr5); Recombinant C-C chemokine receptor type 5 (Ccr5); C-C chemokine receptor type 5; C-C CKR-5; CC-CKR-5; CCR-5; MIP-1 alpha receptor CD_antigen= CD195; Ccr5 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-354
Sequence
MDFQGSIPTYIYDIDYSMSAPCQKVNVKQIAAQLLPPLYSLVFIFGFVGNMMVFLILISCKKLKSMTDIYLFNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKLFTGIYHIGYFGGIFFIILLTIDRYLAIVHAVFAIKARTVNFGVITSVVTWVVAVFVSLPEIIFMRSQKEGSHYTCSPHFLHIQYRFWKHFQTLKMVILSLILPLLVMVICYSGILNTLFRCRNEKKRHRAVRLIFAIMIVYFLFWTPYNIVLLLTTFQEYFGLNNCSSSNRLDQAMQVTETLGMTHCCLNPVIYAFVGEKFRNYLSVFFRKHIVKRFCKHCSIFQQVNPDRVSSVYTRSTGEQEVSTGL
Sequence Length
354
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,031 Da
NCBI Official Full Name
C-C chemokine receptor type 5
NCBI Official Synonym Full Names
chemokine (C-C motif) receptor 5
NCBI Official Symbol
Ccr5
NCBI Official Synonym Symbols
Ckr5; Cmkbr5
NCBI Protein Information
C-C chemokine receptor type 5; CCR-5; CC-CKR-5; C-C CKR-5; MIP-1 alpha receptor; chemokine (C-C) receptor 5
UniProt Protein Name
C-C chemokine receptor type 5
Protein Family
UniProt Gene Name
Ccr5
UniProt Synonym Gene Names
Cmkbr5; C-C CKR-5; CC-CKR-5; CCR-5
UniProt Entry Name
CCR5_RAT

NCBI Description

G protein-coupled receptor; involved in regulation of leukocyte activation and migration [RGD, Feb 2006]

Uniprot Description

CCR5: a 7-transmembrane G-linked receptor for a number of inflammatory C-C type chemokines including MIP-1-alpha, MIP-1-beta and RANTES. Transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Acts as a coreceptor (along with CD4) for HIV-1 R5 isolates. Interacts with PRAF2. Interacts with HIV-1 surface protein gp120. Efficient ligand binding to CCL3/MIP-1alpha and CCR4/MIP-1beta requires sulfation, O-glycosylation and sialic acid modifications. Glycosylation on S6 is required for efficient binding of CCL4. Interacts with ADRBK1. Interacts with ARRB1 and ARRB2. Variations in CCR5 are associated with resistance or susceptibility to immunodeficiency virus type 1 (resistance or susceptibility to HIV-1). Variations in CCR5 gene also influence the rate of progression to AIDS after infection. R60S variant, a naturally occurring mutation in a conserved residue in the first intracellular domain of CCR5, results in reduced amounts of the protein in the membrane and consequently may be associated with reduced susceptibility to infection by microbes that depend on these molecules as their receptors. Variations in CCR5 are associated with susceptibility to West Nile virus (WNV) infection

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Receptor, cytokine; GPCR, family 1; Motility/polarity/chemotaxis; Receptor, GPCR

Cellular Component: cell surface; cytoplasm; plasma membrane; integral to membrane; endosome; external side of plasma membrane

Molecular Function: protein binding; C-C chemokine receptor activity; C-C chemokine binding; glycoprotein binding; actin binding; protein kinase binding

Biological Process: fat cell differentiation; response to lipopolysaccharide; defense response; negative regulation of axon extension; positive regulation of interleukin-1 beta secretion; chemotaxis; positive regulation of apoptosis by virus; elevation of cytosolic calcium ion concentration; cell-cell signaling; calcium ion transport; forebrain development; positive regulation of cell-cell adhesion; inflammatory response; negative regulation of cell migration; aging; calcium-mediated signaling; MAPKKK cascade; positive regulation of interleukin-6 production; release of sequestered calcium ion by sarcoplasmic reticulum into cytosol; positive regulation of tumor necrosis factor production; G-protein coupled receptor protein signaling pathway; inflammatory response to antigenic stimulus; defense response to bacterium; positive regulation of fever; response to ionizing radiation; positive regulation of neuron differentiation; leukocyte migration; positive regulation of inflammatory response

Research Articles on Ccr5

Similar Products

Product Notes

The Ccr5 ccr5 (Catalog #AAA1239909) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-354. The amino acid sequence is listed below: MDFQGSIPTY IYDIDYSMSA PCQKVNVKQI AAQLLPPLYS LVFIFGFVGN MMVFLILISC KKLKSMTDIY LFNLAISDLL FLLTLPFWAH YAANEWVFGN IMCKLFTGIY HIGYFGGIFF IILLTIDRYL AIVHAVFAIK ARTVNFGVIT SVVTWVVAVF VSLPEIIFMR SQKEGSHYTC SPHFLHIQYR FWKHFQTLKM VILSLILPLL VMVICYSGIL NTLFRCRNEK KRHRAVRLIF AIMIVYFLFW TPYNIVLLLT TFQEYFGLNN CSSSNRLDQA MQVTETLGMT HCCLNPVIYA FVGEKFRNYL SVFFRKHIVK RFCKHCSIFQ QVNPDRVSSV YTRSTGEQEV STGL. It is sometimes possible for the material contained within the vial of "C-C chemokine receptor type 5 (Ccr5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.