Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

C-C chemokine receptor type 4 (Ccr4) Recombinant Protein | Ccr4 recombinant protein

Recombinant Mouse C-C chemokine receptor type 4 (Ccr4)

Gene Names
Ccr4; LESTR; Sdf1r; CHEMR1; Cmkbr4; C-C CKR-4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-C chemokine receptor type 4 (Ccr4); Recombinant Mouse C-C chemokine receptor type 4 (Ccr4); Ccr4 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-360aa; Full length protein
Sequence
MNATEVTDTTQDETVYNSYYFYESMPKPCTKEGIKAFGEVFLPPLYSLVFLLGLFGNSVV VLVLFKYKRLKSMTDVYLLNLAISDLLFVLSLPFWGYYAADQWVFGLGLCKIVSWMYLVG FYSGIFFIMLMSIDRYLAIVHAVFSLKARTLTYGVITSLITWSVAVFASLPGLLFSTCYT EHNHTYCKTQYSVNSTTWKVLSSLEINVLGLLIPLGIMLFCYSMIIRTLQHCKNEKKNRA VRMIFAVVVLFLGFWTPYNVVLFLETLVELEVLQDCTLERYLDYAIQATETLAFIHCCLN PVIYFFLGEKFRKYITQLFRTCRGPLVLCKHCDFLQVYSADMSSSSYTQSTVDHDFRDAL
Sequence Length
360
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Ccr4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,408 Da
NCBI Official Full Name
C-C chemokine receptor type 4
NCBI Official Synonym Full Names
chemokine (C-C motif) receptor 4
NCBI Official Symbol
Ccr4
NCBI Official Synonym Symbols
LESTR; Sdf1r; CHEMR1; Cmkbr4; C-C CKR-4
NCBI Protein Information
C-C chemokine receptor type 4
UniProt Protein Name
C-C chemokine receptor type 4
Protein Family
UniProt Gene Name
Ccr4
UniProt Synonym Gene Names
Cmkbr4; C-C CKR-4; CC-CKR-4; CCR-4; CCR4
UniProt Entry Name
CCR4_MOUSE

Uniprot Description

CCR4: High affinity receptor for the C-C type chemokines CCL17/TARC and CCL22/MDC. The activity of this receptor is mediated by G(i) proteins which activate a phosphatidylinositol- calcium second messenger system. Can function as a chemoattractant homing receptor on circulating memory lymphocytes and as a coreceptor for some primary HIV-2 isolates. In the CNS, could mediate hippocampal-neuron survival. Belongs to the G-protein coupled receptor 1 family.

Protein type: Motility/polarity/chemotaxis; GPCR, family 1; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: cell soma; external side of plasma membrane; integral to membrane; membrane; plasma membrane

Molecular Function: C-C chemokine receptor activity; chemokine receptor activity; G-protein coupled receptor activity; signal transducer activity

Biological Process: chemotaxis; G-protein coupled receptor protein signaling pathway; homeostasis of number of cells; immune response; inflammatory response; neuron migration; positive regulation of positive chemotaxis; signal transduction; tolerance induction

Research Articles on Ccr4

Similar Products

Product Notes

The Ccr4 ccr4 (Catalog #AAA7011017) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-360aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Ccr4 ccr4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNATEVTDTT QDETVYNSYY FYESMPKPCT KEGIKAFGEV FLPPLYSLVF LLGLFGNSVV VLVLFKYKRL KSMTDVYLLN LAISDLLFVL SLPFWGYYAA DQWVFGLGLC KIVSWMYLVG FYSGIFFIML MSIDRYLAIV HAVFSLKART LTYGVITSLI TWSVAVFASL PGLLFSTCYT EHNHTYCKTQ YSVNSTTWKV LSSLEINVLG LLIPLGIMLF CYSMIIRTLQ HCKNEKKNRA VRMIFAVVVL FLGFWTPYNV VLFLETLVEL EVLQDCTLER YLDYAIQATE TLAFIHCCLN PVIYFFLGEK FRKYITQLFR TCRGPLVLCK HCDFLQVYSA DMSSSSYTQS TVDHDFRDAL. It is sometimes possible for the material contained within the vial of "C-C chemokine receptor type 4 (Ccr4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.