Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

E3 ubiquitin-protein ligase CCNB1IP1 (CCNB1IP1) Recombinant Protein | CCNB1IP1 recombinant protein

Recombinant Human E3 ubiquitin-protein ligase CCNB1IP1 (CCNB1IP1)

Gene Names
CCNB1IP1; HEI10; C14orf18
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase CCNB1IP1 (CCNB1IP1); Recombinant Human E3 ubiquitin-protein ligase CCNB1IP1 (CCNB1IP1); CCNB1IP1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-277, Full length protein
Sequence
MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQMEKIYTQQIQSKDVELTSMKGEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIANHEGTLEPSMIAQSGVLGFPLGNNSKFPLDNTPVRNRGDGDGDFQFRPFFAGSPTAPEPSNSFFSFVSPSRELEQQQVSSRAFKVKRI
Sequence Length
277
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,544 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase CCNB1IP1
NCBI Official Synonym Full Names
cyclin B1 interacting protein 1
NCBI Official Symbol
CCNB1IP1
NCBI Official Synonym Symbols
HEI10; C14orf18
NCBI Protein Information
E3 ubiquitin-protein ligase CCNB1IP1
UniProt Protein Name
E3 ubiquitin-protein ligase CCNB1IP1
UniProt Gene Name
CCNB1IP1
UniProt Synonym Gene Names
C14orf18; HEI10

NCBI Description

HEI10 is a member of the E3 ubiquitin ligase family and functions in progression of the cell cycle through G(2)/M.[supplied by OMIM, Apr 2004]

Uniprot Description

Ubiquitin E3 ligase that acts as a limiting factor for crossing-over during meiosis: required during zygonema to limit the colocalization of RNF212 with MutS-gamma-associated recombination sites and thereby establish early differentiation of crossover and non-crossover sites. Later, it is directed by MutL-gamma to stably accumulate at designated crossover sites. Probably promotes the dissociation of RNF212 and MutS-gamma to allow the progression of recombination and the implementation of the final steps of crossing over (). Modulates cyclin-B levels and participates in the regulation of cell cycle progression through the G2 phase. Overexpression causes delayed entry into mitosis.

Research Articles on CCNB1IP1

Similar Products

Product Notes

The CCNB1IP1 ccnb1ip1 (Catalog #AAA1458147) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-277, Full length protein. The amino acid sequence is listed below: MSLCEDMLLC NYRKCRIKLS GYAWVTACSH IFCDQHGSGE FSRSPAICPA CNSTLSGKLD IVRTELSPSE EYKAMVLAGL RPEIVLDISS RALAFWTYQV HQERLYQEYN FSKAEGHLKQ MEKIYTQQIQ SKDVELTSMK GEVTSMKKVL EEYKKKFSDI SEKLMERNRQ YQKLQGLYDS LRLRNITIAN HEGTLEPSMI AQSGVLGFPL GNNSKFPLDN TPVRNRGDGD GDFQFRPFFA GSPTAPEPSN SFFSFVSPSR ELEQQQVSSR AFKVKRI. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase CCNB1IP1 (CCNB1IP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.