C-C motif chemokine 8 Recombinant Protein | CCL8 recombinant protein

Recombinant Human C-C motif chemokine 8

Cat. Num. AAA948535

• Gene Names: CCL8; HC14; MCP2; MCP-2; SCYA8; SCYA10
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-C motif chemokine 8; Recombinant Human C-C motif chemokine 8; HC14; Monocyte chemoattractant protein 2; Monocyte chemotactic protein 2; MCP-2; Small-inducible cytokine A8; CCL8 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 24-99aa; Full Length
• Sequence: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
• Sequence Length: 99

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for CCL8 recombinant protein

Chotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chotactic activity, but inhibits the chotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.

Product Categories/Family for CCL8 recombinant protein

Immunology

References

The human MCP-2 gene (SCYA8) cloning, sequence analysis, tissue expression, and assignment to the CC chemokine gene contig on chromosome 17q11.2.van Coillie E., Fiten P., Nomiyama H., Sakaki Y., Miura R., Yoshie O., van Damme J., Opdenakker G.Genomics 40:323-331(1997) Human monocyte chemotactic protein-2 cDNA cloning and regulated expression of mRNA in mesenchymal cells.van Coillie E., Froyen F., Nomiyama H., Miura R., Fiten P., van Aelst I., van Damme J., Opdenakker G.Biochem. Biophys. Res. Commun. 231:726-730(1997) Cloning and expression of a gamma-interferon-inducible gene in monocytes a new member of a cytokine gene family.Chang H.C., Hsu F., Freeman G.J., Griffin J.D., Reinherz E.L.Int. Immunol. 1:388-397(1989) Structural and functional identification of two human, tumor-derived monocyte chemotactic proteins (MCP-2 and MCP-3) belonging to the chemokine family.van Damme J., Proost P., Lenaerts J.-P., Opdenakker G.J. Exp. Med. 176:59-65(1992) Structural characterization of a monomeric chemokine monocyte chemoattractant protein-3.Kim K.-S., Rajarathnam K., Clark-Lewis I., Sykes B.D.FEBS Lett. 395:277-282(1996) Posttranslational modifications affect the activity of the human monocyte chemotactic proteins MCP-1 and MCP-2 identification of MCP-2(6-76) as a natural chemokine inhibitor.Proost P., Struyf S., Couvreur M., Lenaerts J.-P., Conings R., Menten P., Verhaert P., Wuyts A., Van Damme J.J. Immunol. 160:4034-4041(1998) Complete crystal structure of monocyte chemotactic protein-2, a CC chemokine that interacts with multiple receptors.Blaszczyk J., Coillie E.V., Proost P., Damme J.V., Opdenakker G., Bujacz G.D., Wang J.M., Ji X.Biochemistry 39:14075-14081(2000)

NCBI and Uniprot Product Information

• NCBI GI #: 22538816
• NCBI GeneID: 6355
• NCBI Accession #: NP_005614.2
• NCBI GenBank Nucleotide #: NM_005623.2
• UniProt Accession #: P80075; P78388; A0AV77
• Molecular Weight: 10.9 kDa
• NCBI Official Full Name: C-C motif chemokine 8
• NCBI Official Synonym Full Names: chemokine (C-C motif) ligand 8
• NCBI Official Symbol: CCL8
• NCBI Official Synonym Symbols: HC14; MCP2; MCP-2; SCYA8; SCYA10
• NCBI Protein Information: C-C motif chemokine 8
• UniProt Protein Name: C-C motif chemokine 8
• Protein Family: C-C motif chemokine
• UniProt Gene Name: CCL8
• UniProt Synonym Gene Names: MCP2; SCYA10; SCYA8; MCP-2
• UniProt Entry Name: CCL8_HUMAN

NCBI Description

This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils. By recruiting leukocytes to sites of inflammation this cytokine may contribute to tumor-associated leukocyte infiltration and to the antiviral state against HIV infection. [provided by RefSeq, Sep 2014]

Uniprot Description

CCL8: Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide; Chemokine

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: cell; extracellular space

Molecular Function: CCR chemokine receptor binding; CCR2 chemokine receptor binding; chemokine activity; heparin binding; phospholipase activator activity; protein kinase activity

Biological Process: angiogenesis; calcium ion transport; cell-cell signaling; cellular calcium ion homeostasis; chemotaxis; exocytosis; G-protein coupled receptor protein signaling pathway; inflammatory response; lymphocyte chemotaxis; monocyte chemotaxis; neutrophil chemotaxis; positive regulation of GTPase activity; positive regulation of inflammatory response; positive regulation of leukocyte migration; protein amino acid phosphorylation; response to virus; signal transduction