Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human CCL18/PARC Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

CCL18/PARC Recombinant Protein | CCL18 recombinant protein

Recombinant Human CCL18/PARC Protein

Gene Names
CCL18; CKb7; PARC; AMAC1; DCCK1; MIP-4; AMAC-1; DC-CK1; SCYA18
Purity
>95% by SDS-PAGE.
Synonyms
CCL18/PARC; Recombinant Human CCL18/PARC Protein; C-C Motif Chemokine 18; Alternative Macrophage Activation-Associated CC Chemokine 1; AMAC-1; CC Chemokine PARC; Dendritic Cell Chemokine 1; DC-CK1; Macrophage Inflammatory Protein4; MIP-4; Pulmonary and Activation-Regulated Chemokine; Small-Inducible Cyto; CCL18 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
Sequence
AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Sequence Length
89
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the N-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human CCL18/PARC Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human CCL18/PARC Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for CCL18 recombinant protein
Description: Recombinant Human CCL18/PARC Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala21-Ala89) of human CCL18/PARC (Accession #P55774) fused with an initial Met at the N-terminus and a 6xHis tag at the N-terminus.

Background: C-C Motif Chemokine 18 (CCL18) is secreted protein that belongs to the intercrine beta (chemokine CC) family.CCL18 is expressed at high levels in the lung, lymph nodes, placenta, bone marrow, and dendritic cells. CCL18 isa chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. CCL18 is a novel CCchemokine that is highly homologous to MIP-1 alpha. CCL18 may be involved in B-cell migration into B-cellfollicles in lymph nodes. CCL18 attracts naive T-lymphocytes toward dendritic cells and activated macrophagesin lymph nodes. It has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role inboth humoral and cell-mediated immunity responses.
Product Categories/Family for CCL18 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
alternative macrophage activation-associated CC-chemokine
NCBI Official Synonym Full Names
C-C motif chemokine ligand 18
NCBI Official Symbol
CCL18
NCBI Official Synonym Symbols
CKb7; PARC; AMAC1; DCCK1; MIP-4; AMAC-1; DC-CK1; SCYA18
NCBI Protein Information
C-C motif chemokine 18
UniProt Protein Name
C-C motif chemokine 18
Protein Family
UniProt Gene Name
CCL18
UniProt Synonym Gene Names
AMAC1; DCCK1; MIP4; PARC; SCYA18; AMAC-1; DC-CK1; MIP-4
UniProt Entry Name
CCL18_HUMAN

NCBI Description

This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for naive T cells, CD4+ and CD8+ T cells and nonactivated lymphocytes, but not for monocytes or granulocytes. This chemokine attracts naive T lymphocytes toward dendritic cells and activated macrophages in lymph nodes. It may play a role in both humoral and cell-mediated immunity responses. [provided by RefSeq, Sep 2014]

Uniprot Description

CCL18: Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted; Chemokine

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: extracellular space

Molecular Function: protein binding; chemokine activity

Biological Process: cell-cell signaling; response to biotic stimulus; immune response; cell communication; chemotaxis; signal transduction; inflammatory response

Research Articles on CCL18

Similar Products

Product Notes

The CCL18 ccl18 (Catalog #AAA9140240) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: AQVGTNKELC CLVYTSWQIP QKFIVDYSET SPQCPKPGVI LLTKRGRQIC ADPNKKWVQK YISDLKLNA. It is sometimes possible for the material contained within the vial of "CCL18/PARC, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.