Calcineurin B-like protein 3 (CBL3) Recombinant Protein | CBL3 recombinant protein
Recombinant Arabidopsis thaliana Calcineurin B-like protein 3 (CBL3)
Gene Names
CBL3; ATCBL3; calcineurin B-like 3; T15N24.20; T15N24_20
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcineurin B-like protein 3 (CBL3); Recombinant Arabidopsis thaliana Calcineurin B-like protein 3 (CBL3); CBL3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-226, Full length protein
Sequence
MSQCIDGFKHVCSSFFRCFDIDIYKQSGGLGDPELLARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPIEDKIDFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLSDEIIESIIDKTFEEADTKHDGRIDKEEWRTLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT
Sequence Length
226
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,538 Da
NCBI Official Full Name
calcineurin B-like 3
NCBI Official Symbol
CBL3
NCBI Official Synonym Symbols
ATCBL3; calcineurin B-like 3; T15N24.20; T15N24_20
NCBI Protein Information
calcineurin B-like 3
UniProt Protein Name
Calcineurin B-like protein 3
Protein Family
UniProt Gene Name
CBL3
UniProt Synonym Gene Names
SCABP6
NCBI Description
member of AtCBLs (Calcineurin B-like Calcium Sensor Proteins)
Uniprot Description
Acts as a calcium sensor. CBL proteins interact with CIPK serine-threonine protein kinases. Binds calcium ions. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner. Mediates the activation of AKT1 by CIPK proteins (CIPK6, CIPK16, and CIPK23) in response to low potassium conditions and in the context of stomatal movement. Negatively regulates the enzyme activity of MTN1 in the presence of calcium.
Research Articles on CBL3
Similar Products
Product Notes
The CBL3 cbl3 (Catalog #AAA1392893) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-226, Full length protein. The amino acid sequence is listed below: MSQCIDGFKH VCSSFFRCFD IDIYKQSGGL GDPELLARET VFSVSEIEAL YELFKKISSA VIDDGLINKE EFQLALFKTN KKESLFADRV FDLFDTKHNG ILGFEEFARA LSVFHPNAPI EDKIDFSFQL YDLKQQGFIE RQEVKQMVVA TLAESGMNLS DEIIESIIDK TFEEADTKHD GRIDKEEWRT LVLRHPSLLK NMTLQYLKDI TTTFPSFVFH SQVEDT. It is sometimes possible for the material contained within the vial of "Calcineurin B-like protein 3 (CBL3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
