Caspase recruitment domain-containing protein 16 (CARD16) Recombinant Protein | CARD16 recombinant protein

Recombinant Human Caspase recruitment domain-containing protein 16 (CARD16)

Cat. Num. AAA1419691

• Gene Names: CARD16; COP; COP1; PSEUDO-ICE
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Caspase recruitment domain-containing protein 16 (CARD16); Recombinant Human Caspase recruitment domain-containing protein 16 (CARD16); CARD16 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-197, Full length protein
• Sequence: MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAALQAVQDNPAMPTCSSPEGRIKLCFLEDAQRIWKQKLQRCHVQNTIIKWSERYTSGSFEMQWLFLRTNFIERFWRNILLLPLHKGSLYPRIPGLGKELQTGTHKLS
• Sequence Length: 197

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 62953113
• NCBI GeneID: 114769
• NCBI Accession #: NP_001017534.1
• NCBI GenBank Nucleotide #: NM_001017534.1
• UniProt Accession #: Q5EG05; Q96RJ9
• Molecular Weight: 10,737 Da
• NCBI Official Full Name: caspase recruitment domain-containing protein 16 isoform 1
• NCBI Official Synonym Full Names: caspase recruitment domain family member 16
• NCBI Official Symbol: CARD16
• NCBI Official Synonym Symbols: COP; COP1; PSEUDO-ICE
• NCBI Protein Information: caspase recruitment domain-containing protein 16
• UniProt Protein Name: Caspase recruitment domain-containing protein 16
• Protein Family: Caspase recruitment domain-containing protein
• UniProt Gene Name: CARD16
• UniProt Synonym Gene Names: COP; COP1; CARD-only protein 1; Pseudo-ICE; Pseudo-IL1B-converting enzyme

Uniprot Description

Caspase inhibitor. Acts as a regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-interleukin-1 beta (IL1B) and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. Also induces NF-kappa-B activation during the pro-inflammatory cytokine response. Also able to inhibit CASP1-mediated neuronal cell death, TNF-alpha, hypoxia-, UV-, and staurosporine-mediated cell death but not ER stress-mediated cell death. Acts by preventing activation of caspases CASP1 and CASP4, possibly by preventing the interaction between CASP1 and RIPK2.