Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Capsule biosynthesis protein CapA (capA) Recombinant Protein | pxo2_56 recombinant protein

Recombinant Capsule biosynthesis protein CapA (capA)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Capsule biosynthesis protein CapA (capA); Recombinant Capsule biosynthesis protein CapA (capA); Capsule biosynthesis protein CapA; pxo2_56 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-411
Sequence
MRRKLTFQEKLLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKLTMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKADKNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFKDVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNADLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLGNFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPVTSALDKNRVYRQLTKDTSKGALWSKKDDKLEIKLNHKHVIEKMKKREKQEHQDKQEKENQVSVETTT
Sequence Length
411
Species
Bacillus anthracis
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,453 Da
NCBI Official Full Name
hypothetical protein pxo2_56
NCBI Official Symbol
pxo2_56
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Capsule biosynthesis protein CapA
UniProt Gene Name
capA
UniProt Entry Name
CAPA_BACAN

Uniprot Description

Function: Essential for the synthesis of the polyglutamate capsule of B.anthracis which is one of the principal virulence factors during anthrax infection. May form a polyglutamyl synthetase complex together with proteins CapB and CapC.

Pathway: Capsule biogenesis; capsule polysaccharide biosynthesis.

Subcellular location: Cell membrane; Single-pass membrane protein.

Induction: Capsule synthesis is transcriptionally regulated by AtxA, AcpA and AcpB. Ref.6

Sequence similarities: Belongs to the CapA family.

Similar Products

Product Notes

The pxo2_56 capa (Catalog #AAA1058011) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-411. The amino acid sequence is listed below: MRRKLTFQEK LLIFIKKTKK KNPRYVAIVL PLIAVILIAA TWVQRTEAVA PVKHRENEKL TMTMVGDIMM GRHVKEIVNR YGTDYVFRHV SPYLKNSDYV SGNFEHPVLL EDKKNYQKAD KNIHLSAKEE TVKAVKEAGF TVLNLANNHM TDYGAKGTKD TIKAFKEADL DYVGAGENFK DVKNIVYQNV NGVRVATLGF TDAFVAGAIA TKEQPGSLSM NPDVLLKQIS KAKDPKKGNA DLVVVNTHWG EEYDNKPSPR QEALAKAMVD AGADIIVGHH PHVLQSFDVY KQGIIFYSLG NFVFDQGWTR TKDSALVQYH LRDNGTAILD VVPLNIQEGS PKPVTSALDK NRVYRQLTKD TSKGALWSKK DDKLEIKLNH KHVIEKMKKR EKQEHQDKQE KENQVSVETT T. It is sometimes possible for the material contained within the vial of "Capsule biosynthesis protein CapA (capA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual