Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Calcium-binding tyrosine phosphorylation-regulated protein (Cabyr) Recombinant Protein | Cabyr recombinant protein

Recombinant Mouse Calcium-binding tyrosine phosphorylation-regulated protein (Cabyr)

Gene Names
Cabyr; CBP86; FSP-2; 1700016C01Rik; 4933421A18Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcium-binding tyrosine phosphorylation-regulated protein (Cabyr); Recombinant Mouse Calcium-binding tyrosine phosphorylation-regulated protein (Cabyr); Cabyr recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-453, full length protein
Sequence
MISSKPRLVVPYGLKTLLEGVSRAILKTNPTNITQFAAVYFKELIVFREGNSSLDIKDLIKQFHQMKVEKWAEGVTVEKKECIKEPIKPPPVPCKPTHMEKSTDTEEDNVAGPLFSNKTTQFPSVHAEVQSEETSEGARGPSDKPTTPKTDYTPPSSPPPAPVSAEYAYVPADPAQFAAQMLGNVPSTYSEVLMVDVATSTPAVPQDVLSAEFAEEVVLSAPLVCSGETVEVQVVSKTSAQVVVGPVSEAEPPKASSAPLQGEQEPPAHEAPDTQVTSASRISSIYNDVPVNEGVVYVEEIPGYIVIPFTDHDQVACVKEIEQSPPGSPKAVEPKTKISIESLKTVQVEENSQHKSSVHVEAEATVLLSNTALDGQPEVPAEPLDAEGFFKVASENSLHLETEIVIINPDDPGQEESGGNAAPHSSGDPFPPAPGGLTEPEMQPDGEAAPEQV
Sequence Length
453
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cabyr recombinant protein
To reach fertilization competence, spermatozoa undergo a series of morphological and molecular maturational processes, termed capacitation, involving protein tyrosine phosphorylation and increased intracellular calcium. This protein localizes to the principal piece of the sperm flagellum in association with the fibrous sheath and exhibits calcium-binding when phosphorylated during capacitation. A pseudogene on chromosome 3 has been identified for this gene. Transcript variants of this gene encode multiple protein isoforms. An additional transcript and isoform has not been fully characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,985 Da
NCBI Official Full Name
calcium-binding tyrosine phosphorylation-regulated protein isoform a
NCBI Official Synonym Full Names
calcium-binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2)
NCBI Official Symbol
Cabyr
NCBI Official Synonym Symbols
CBP86; FSP-2; 1700016C01Rik; 4933421A18Rik
NCBI Protein Information
calcium-binding tyrosine phosphorylation-regulated protein
UniProt Protein Name
Calcium-binding tyrosine phosphorylation-regulated protein
UniProt Gene Name
Cabyr
UniProt Synonym Gene Names
Cbp86

Uniprot Description

May function as a regulator of both motility- and head-associated functions such as capacitation and the acrosome reaction. May bind calcium in vitro ().

Research Articles on Cabyr

Similar Products

Product Notes

The Cabyr cabyr (Catalog #AAA1327548) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-453, full length protein. The amino acid sequence is listed below: MISSKPRLVV PYGLKTLLEG VSRAILKTNP TNITQFAAVY FKELIVFREG NSSLDIKDLI KQFHQMKVEK WAEGVTVEKK ECIKEPIKPP PVPCKPTHME KSTDTEEDNV AGPLFSNKTT QFPSVHAEVQ SEETSEGARG PSDKPTTPKT DYTPPSSPPP APVSAEYAYV PADPAQFAAQ MLGNVPSTYS EVLMVDVATS TPAVPQDVLS AEFAEEVVLS APLVCSGETV EVQVVSKTSA QVVVGPVSEA EPPKASSAPL QGEQEPPAHE APDTQVTSAS RISSIYNDVP VNEGVVYVEE IPGYIVIPFT DHDQVACVKE IEQSPPGSPK AVEPKTKISI ESLKTVQVEE NSQHKSSVHV EAEATVLLSN TALDGQPEVP AEPLDAEGFF KVASENSLHL ETEIVIINPD DPGQEESGGN AAPHSSGDPF PPAPGGLTEP EMQPDGEAAP EQV. It is sometimes possible for the material contained within the vial of "Calcium-binding tyrosine phosphorylation-regulated protein (Cabyr), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.