SDS-PAGE
Carbonic anhydrase 1 Recombinant Protein | Ca1 recombinant protein
Recombinant Rat Carbonic anhydrase 1
Gene Names
Car1; Ca1; CA-I
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Carbonic anhydrase 1; Recombinant Rat Carbonic anhydrase 1; Carbonate dehydratase I; Ca1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-261aa; Full Length
Sequence
ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF
Sequence Length
261
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Ca1 recombinant protein
Reversible hydration of carbon dioxide. Curated
References
Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
Proteome profile of the mature rat olfactory bulb.Maurya D.K., Sundaram C.S., Bhargava P.Proteomics 9:2593-2599(2009)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30.2 kDa
NCBI Official Full Name
carbonic anhydrase 1
NCBI Official Synonym Full Names
carbonic anhydrase I
NCBI Official Symbol
Car1
NCBI Official Synonym Symbols
Ca1; CA-I
NCBI Protein Information
carbonic anhydrase 1
UniProt Protein Name
Carbonic anhydrase 1
Protein Family
UniProt Gene Name
Ca1
UniProt Synonym Gene Names
CA-I
UniProt Entry Name
CAH1_RAT
Uniprot Description
CA1: Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea. Belongs to the alpha-carbonic anhydrase family.
Protein type: Lyase; EC 4.2.1.1; Energy Metabolism - nitrogen
Cellular Component: cytoplasm
Molecular Function: arylesterase activity; carbonate dehydratase activity; hydro-lyase activity; zinc ion binding
Biological Process: one-carbon compound metabolic process
Research Articles on Ca1
Similar Products
Product Notes
The Ca1 ca1 (Catalog #AAA1015683) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-261aa; Full Length. The amino acid sequence is listed below: ASADWGYDSK NGPDQWSKLY PIANGNNQSP IDIKTSEAKH DSSLKPVSVS YNPATAKEIV NVGHSFHVVF DDSSNQSVLK GGPLADSYRL TQFHFHWGNS NDHGSEHTVD GAKYSGELHL VHWNSAKYSS AAEAISKADG LAIIGVLMKV GPANPNLQKV LDALSSVKTK GKRAPFTNFD PSSLLPSSLD YWTYFGSLTH PPLHESVTWV ICKESISLSP EQLAQLRGLL SSAEGEPAVP VLSNHRPPQP LKGRTVRASF. It is sometimes possible for the material contained within the vial of "Carbonic anhydrase 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
