Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Complement component C9 (C9) Recombinant Protein | C9 recombinant protein

Recombinant Rabbit Complement component C9 (C9)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Complement component C9 (C9); Recombinant Rabbit Complement component C9 (C9); Recombinant Complement component C9 (C9); Complement component C9; C9 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-557
Sequence
GPTPSYVHEPIQRSDPLQPIDCRMSPWSEWSHCDPCLRQMFRSRSIEVFGQFHGKSCVDALGDRRACIPTEACEDAEEDCEKDEFHCGTGRCIKRRLLCNGDNDCGDFSDEDDCETEPRLTCRNREVQESELARTAGYGINILGMDPLATPFDNEYYHGLCDRVWDGNTLTHYRKPWNVAVLAYETKIDKNFRTEYYEEQMQAFKSIIEEETSNFNANLALKFTPTEAKASKAEEASPKNKSLDDNDKGFSSKFQFSYSKNETYQLFLSYSSQKEKMFLLVKGIIQLGRFVMKNRGVMLTNTFLDDIKSLPTTYEKGEYFAFLETYGTHYSSSGSLGGRYELIYVLDKASMKEKGIELNDIKKCLGFDLDLSLNIPGKSAGLSLTGQANKNNCLKSGHGNAVNITRANLIDDVISLIRGGTQKFAFELKEKLLTKAKMVDVTDFINWASSLSDAPVLINQKLSPIYNLIPVKIKDAHQKRQNLERGIEDYINEFSTKKCSPCQNGGTALLMDGQCLCTCPFMFEGIACEISKRKLA
Sequence Length
557
Species
Oryctolagus cuniculus (Rabbit)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,662 Da
NCBI Official Full Name
complement component C9
NCBI Official Symbol
C9
NCBI Protein Information
complement component C9
UniProt Protein Name
Complement component C9
Protein Family
UniProt Gene Name
C9
UniProt Entry Name
CO9_RABIT

Uniprot Description

Function: Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. C9 is the pore-forming subunit of the MAC.

Subunit structure: Component of the membrane attack complex (MAC). MAC assembly is initiated by protelytic cleavage of C5 into C5a and C5b. C5b binds sequentially C6, C7, C8 and multiple copies of the pore-forming subunit C9

By similarity.

Subcellular location: Secreted. Cell membrane; Multi-pass membrane protein

By similarity. Note: Secreted as soluble monomer. Oligomerizes at target membranes, forming a pre-pore. A conformation change then leads to the formation of a 100 Angstrom diameter pore

By similarity.

Post-translational modification: Thrombin cleaves factor C9 to produce C9a and C9b.

Sequence similarities: Belongs to the complement C6/C7/C8/C9 family.Contains 1 EGF-like domain.Contains 1 LDL-receptor class A domain.Contains 1 MACPF domain.Contains 1 TSP type-1 domain.

Similar Products

Product Notes

The C9 c9 (Catalog #AAA948088) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-557. The amino acid sequence is listed below: GPTPSYVHEP IQRSDPLQPI DCRMSPWSEW SHCDPCLRQM FRSRSIEVFG QFHGKSCVDA LGDRRACIPT EACEDAEEDC EKDEFHCGTG RCIKRRLLCN GDNDCGDFSD EDDCETEPRL TCRNREVQES ELARTAGYGI NILGMDPLAT PFDNEYYHGL CDRVWDGNTL THYRKPWNVA VLAYETKIDK NFRTEYYEEQ MQAFKSIIEE ETSNFNANLA LKFTPTEAKA SKAEEASPKN KSLDDNDKGF SSKFQFSYSK NETYQLFLSY SSQKEKMFLL VKGIIQLGRF VMKNRGVMLT NTFLDDIKSL PTTYEKGEYF AFLETYGTHY SSSGSLGGRY ELIYVLDKAS MKEKGIELND IKKCLGFDLD LSLNIPGKSA GLSLTGQANK NNCLKSGHGN AVNITRANLI DDVISLIRGG TQKFAFELKE KLLTKAKMVD VTDFINWASS LSDAPVLINQ KLSPIYNLIP VKIKDAHQKR QNLERGIEDY INEFSTKKCS PCQNGGTALL MDGQCLCTCP FMFEGIACEI SKRKLA. It is sometimes possible for the material contained within the vial of "Complement component C9 (C9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.