Complement component C8 alpha chain (C8a) Recombinant Protein | C8a recombinant protein
Recombinant Mouse Complement component C8 alpha chain (C8a)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Complement component C8 alpha chain (C8a); Recombinant Mouse Complement component C8 alpha chain (C8a); C8a recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
31-587, Full length protein
Sequence
AVTPQAVSCQLSDWYKWTDCFPCQDKKYRYRSLLQPSKFGGTICSGDIWDEASCDSPTPCLRQAQCGQDFQCRETGRCLKRHLVCNGDNDCLDGSDESDCEDVRVTEDDCHQYEPIPGSERAALGYNILTQEEAQSVYDAKYYGGQCETVYNGDWRKLRYDPTCERLYYGEDEKYFRKPYNFLKYHFEALADTSISSEFYDDANDLFFHIKNGKSHSAGVTVGVAPVKSPVSIEVTGSGSKASSFLNKLNKYNEKRYGFMRVSTKIQTAQFKMRRNNIVLDEGMLQSLMELPEQFNYGMYAKFINDYGTHYITSGTMGGIYEYVMVLDKEKMKTEGTTVDEVQKCIGGGIGIGIKDSTIEGVGISGEFCENSGDGDRDIRKKITGVEDIISRVQGGSSVWGSVLTHNSSAITYQSWGRSLKYNPVVIDFEMQPIYQLLRHTNLGPLETKRQNLRRALDQYLMEFNACRCGPCFNNGEPILDGTNCRCQCSMGRQGLACERTVIEGLKDFKAAGHWSCWSSWSECRGGSQERRRQCNNPPPKNGGTPCLGRNLQTQAC
Sequence Length
557
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for C8a recombinant protein
C8 is a component of the complement system and contains three polypeptides, alpha, beta and gamma. This gene encodes the alpha subunit of C8. C8 participates in the formation of the membrane attack complex (MAC). The MAC assembles on bacterial membranes to form a pore, permitting disruption of bacterial membrane organization. Mutations in this gene cause complement C8 alpha-gamma deficiency.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
66,080 Da
NCBI Official Full Name
complement component C8 alpha chain isoform 1 preproprotein
NCBI Official Synonym Full Names
complement component 8, alpha polypeptide
NCBI Official Symbol
C8a
NCBI Protein Information
complement component C8 alpha chain
UniProt Protein Name
Complement component C8 alpha chain
Protein Family
UniProt Gene Name
C8a
NCBI Description
This gene encodes the alpha subunit of complement component C8 that participates in the assembly of the complement membrane attack complex. The encoded preproprotein undergoes proteolytic processing to generate the alpha subunit, which associates with the beta and gamma subunits to form a trimeric complement component, C8. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. This gene is located adjacent to the gene encoding the beta subunit. [provided by RefSeq, Oct 2015]
Uniprot Description
Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. C8A inserts into the target membrane, but does not form pores by itself ().
Similar Products
Product Notes
The C8a c8a (Catalog #AAA1469880) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 31-587, Full length protein. The amino acid sequence is listed below: AVTPQAVSCQ LSDWYKWTDC FPCQDKKYRY RSLLQPSKFG GTICSGDIWD EASCDSPTPC LRQAQCGQDF QCRETGRCLK RHLVCNGDND CLDGSDESDC EDVRVTEDDC HQYEPIPGSE RAALGYNILT QEEAQSVYDA KYYGGQCETV YNGDWRKLRY DPTCERLYYG EDEKYFRKPY NFLKYHFEAL ADTSISSEFY DDANDLFFHI KNGKSHSAGV TVGVAPVKSP VSIEVTGSGS KASSFLNKLN KYNEKRYGFM RVSTKIQTAQ FKMRRNNIVL DEGMLQSLME LPEQFNYGMY AKFINDYGTH YITSGTMGGI YEYVMVLDKE KMKTEGTTVD EVQKCIGGGI GIGIKDSTIE GVGISGEFCE NSGDGDRDIR KKITGVEDII SRVQGGSSVW GSVLTHNSSA ITYQSWGRSL KYNPVVIDFE MQPIYQLLRH TNLGPLETKR QNLRRALDQY LMEFNACRCG PCFNNGEPIL DGTNCRCQCS MGRQGLACER TVIEGLKDFK AAGHWSCWSS WSECRGGSQE RRRQCNNPPP KNGGTPCLGR NLQTQAC. It is sometimes possible for the material contained within the vial of "Complement component C8 alpha chain (C8a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
