Complement component C8 gamma chain Recombinant Protein | C8G recombinant protein

Recombinant Human Complement component C8 gamma chain

Cat. Num. AAA958247

• Gene Names: C8G; C8C
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Complement component C8 gamma chain; Recombinant Human Complement component C8 gamma chain; C8G recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 21-202aa; Full Length
• Sequence: QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR
• Sequence Length: 202

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for C8G recombinant protein

C8 is a constituent of the membrane attack complex. C8 binds to the C5B-7 complex, forming the C5B-8 complex. C5-B8 binds C9 and acts as a catalyst in the polymerization of C9. The gamma subunit ses to be able to bind retinol.

Product Categories/Family for C8G recombinant protein

Immunology

References

The eighth component of human complement evidence that it is an oligomeric serum protein assembled from products of three different genes.Ng S.C., Rao A.G., Howard O.M.Z., Sodetz J.M.Biochemistry 26:5229-5233(1987) Structural homology of human complement component C8 gamma and plasma protein HC identity of the cysteine bond pattern.Haefliger J.-A., Jenne D.E., Stanley K.K., Tschopp J.Biochem. Biophys. Res. Commun. 149:750-754(1987) Genomic structure of the human complement protein C8 gamma homology to the lipocalin gene family.Kaufman K.M., Sodetz J.M.Biochemistry 33:5162-5166(1994) DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 166197660
• NCBI GeneID: 733
• NCBI Accession #: NP_000597.2
• NCBI GenBank Nucleotide #: NM_000606.2
• UniProt Accession #: P07360; Q14CT8; Q14CU0; Q5SQ07
• Molecular Weight: 22.9 kDa
• NCBI Official Full Name: complement component C8 gamma chain
• NCBI Official Synonym Full Names: complement component 8, gamma polypeptide
• NCBI Official Symbol: C8G
• NCBI Official Synonym Symbols: C8C
• NCBI Protein Information: complement component C8 gamma chain
• UniProt Protein Name: Complement component C8 gamma chain
• Protein Family: Complement component
• UniProt Gene Name: C8G
• UniProt Entry Name: CO8G_HUMAN

NCBI Description

The protein encoded by this gene belongs to the lipocalin family. It is one of the three subunits that constitutes complement component 8 (C8), which is composed of a disulfide-linked C8 alpha-gamma heterodimer and a non-covalently associated C8 beta chain. C8 participates in the formation of the membrane attack complex (MAC) on bacterial cell membranes. While subunits alpha and beta play a role in complement-mediated bacterial killing, the gamma subunit is not required for the bactericidal activity. [provided by RefSeq, Jul 2011]

Uniprot Description

C8G: C8 is a constituent of the membrane attack complex. C8 binds to the C5B-7 complex, forming the C5B-8 complex. C5-B8 binds C9 and acts as a catalyst in the polymerization of C9. The gamma subunit seems to be able to bind retinol. Belongs to the calycin superfamily. Lipocalin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 9q34.3

Cellular Component: extracellular region; membrane attack complex

Molecular Function: complement binding; protein complex binding; retinol binding

Biological Process: complement activation, alternative pathway; complement activation, classical pathway; cytolysis; innate immune response; regulation of complement activation