Vitamin B12-binding protein Recombinant Protein | SerAS13_0720 recombinant protein

Recombinant E Coli Vitamin B12-binding protein

Cat. Num. AAA955409

• Gene Names: btuF; ECK0157; JW0154; yadT
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Vitamin B12-binding protein; Recombinant E Coli Vitamin B12-binding protein; SerAS13_0720 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 24-266aa; Full Length
• Sequence: PRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
• Sequence Length: 266

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for SerAS13_0720 recombinant protein

Part of the ABC transporter complex BtuCDF involved in vitamin B12 import. Binds vitamin B12 and delivers it to the periplasmic surface of BtuC.

References

Systematic sequencing of the Escherichia coli genome analysis of the 2.4-4.1 min (110,917-193,643 bp) region.Fujita N., Mori H., Yura T., Ishihama A.Nucleic Acids Res. 22:1637-1639(1994) Sequence of minutes 4-25 of Escherichia coli.Chung E., Allen E., Araujo R., Aparicio A.M., Davis K., Duncan M., Federspiel N., Hyman R., Kalman S., Komp C., Kurdi O., Lew H., Lin D., Namath A., Oefner P., Roberts D., Schramm S., Davis R.W. The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Identification of the periplasmic cobalamin-binding protein BtuF of Escherichia coli.Cadieux N., Bradbeer C., Reeger-Schneider E., Koester W., Mohanty A.K., Wiener M.C., Kadner R.J.J. Bacteriol. 184:706-717(2002) The structure of Escherichia coli BtuF and binding to its cognate ATP binding cassette transporter.Borths E.L., Locher K.P., Lee A.T., Rees D.C.Proc. Natl. Acad. Sci. U.S.A. 99:16642-16647(2002) Crystal structures of the BtuF periplasmic-binding protein for vitamin B12 suggest a functionally important reduction in protein mobility upon ligand binding.Karpowich N.K., Huang H.H., Smith P.C., Hunt J.F.J. Biol. Chem. 278:8429-8434(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 16128151
• NCBI GeneID: 947574
• NCBI Accession #: NP_414700.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P37028; P77436
• Molecular Weight: 53.9 kDa
• NCBI Official Full Name: vitamin B12 ABC transporter periplasmic binding protein
• NCBI Official Symbol: btuF
• NCBI Official Synonym Symbols: ECK0157; JW0154; yadT
• NCBI Protein Information: vitamin B12 ABC transporter periplasmic binding protein
• UniProt Protein Name: Vitamin B12-binding protein
• Protein Family: Vitamin B12-binding protein
• UniProt Gene Name: btuF
• UniProt Synonym Gene Names: yadT
• UniProt Entry Name: BTUF_ECOLI

NCBI Description

Uncleaved precursor N-terminus was also sequenced, confirming this start site of translation. about 80% of the precursors had the initial Met cleaved. [More information is available at EcoGene: EG12334]. BtuF is the periplasmic vitamin B12 binding protein that delivers cobalamin to the ABC transporter BtuCD. [More information is available at EcoCyc: EG12334].

Uniprot Description

Part of the ABC transporter complex BtuCDF involved in vitamin B12 import. Binds vitamin B12 and delivers it to the periplasmic surface of BtuC.