SDS-PAGE
Ba(Mycobacterium tuberculosis) Phosphate-binding protein PstS 1 Recombinant Protein | pstS1 recombinant protein
Recombinant Ba(Mycobacterium tuberculosis) Phosphate-binding protein PstS 1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ba(Mycobacterium tuberculosis) Phosphate-binding protein PstS 1; Recombinant Ba(Mycobacterium tuberculosis) Phosphate-binding protein PstS 1; pstS1 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
24-373aa; Partial
Sequence
CGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVKLSDALIATIS
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for pstS1 recombinant protein
Part of the ABC transporter complex PstSACB involved in phosphate import.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
39.8 kDa
Protein Family
Uniprot Description
Part of the ABC transporter complex PstSACB involved in phosphate import.
Similar Products
Product Notes
The pstS1 (Catalog #AAA1265435) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-373aa; Partial. The amino acid sequence is listed below: CGSKPPSGSP ETGAGAGTVA TTPASSPVTL AETGSTLLYP LFNLWGPAFH ERYPNVTITA QGTGSGAGIA QAAAGTVNIG ASDAYLSEGD MAAHKGLMNI ALAISAQQVN YNLPGVSEHL KLNGKVLAAM YQGTIKTWDD PQIAALNPGV NLPGTAVVPL HRSDGSGDTF LFTQYLSKQD PEGWGKSPGF GTTVDFPAVP GALGENGNGG MVTGCAETPG CVAYIGISFL DQASQRGLGE AQLGNSSGNF LLPDAQSIQA AAAGFASKTP ANQAISMIDG PAPDGYPIIN YEYAIVNNRQ KDAATAQTLQ AFLHWAITDG NKASFLDQVH FQPLPPAVVK LSDALIATIS . It is sometimes possible for the material contained within the vial of "Ba(Mycobacterium tuberculosis) Phosphate-binding protein PstS 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
