Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Butyrophilin subfamily 3 member A3 Recombinant Protein | BTN3A3 recombinant protein

Recombinant Human Butyrophilin subfamily 3 member A3

Gene Names
BTN3A3; BTF3; BTN3.3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Butyrophilin subfamily 3 member A3; Recombinant Human Butyrophilin subfamily 3 member A3; BTN3A3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
30-248aa; Extracellular Domain
Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
Sequence Length
374
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for BTN3A3 recombinant protein
Plays a role in T-cell responses in the adaptive immune response.
Product Categories/Family for BTN3A3 recombinant protein
References
A 1.1-Mb transcript map of the hereditary hemochromatosis locus.Ruddy D.A., Kronmal G.S., Lee V.K., Mintier G.A., Quintana L., Domingo R. Jr., Meyer N.C., Irrinki A., McClelland E.E., Fullan A., Mapa F.A., Moore T., Thomas W., Loeb D.B., Harmon C., Tsuchihashi Z., Wolff R.K., Schatzman R.C., Feder J.N.Genome Res. 7:441-456(1997)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25.6 kDa
NCBI Official Full Name
butyrophilin subfamily 3 member A3 isoform c
NCBI Official Synonym Full Names
butyrophilin subfamily 3 member A3
NCBI Official Symbol
BTN3A3
NCBI Official Synonym Symbols
BTF3; BTN3.3
NCBI Protein Information
butyrophilin subfamily 3 member A3
UniProt Protein Name
Butyrophilin subfamily 3 member A3
Protein Family
UniProt Gene Name
BTN3A3
UniProt Synonym Gene Names
BTF3
UniProt Entry Name
BT3A3_HUMAN

NCBI Description

The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin (Ig) domains and an intracellular B30.2 (PRYSPRY) domain. Three subfamilies of human BTN genes are located in the MHC class I region: the single-copy BTN1A1 gene (MIM 601610) and the BTN2 (e.g., BTN2A1; MIM 613590) and BTN3 (e.g., BNT3A3) genes, which have undergone tandem duplication, resulting in 3 copies of each (summary by Smith et al., 2010 [PubMed 20208008]).[supplied by OMIM, Nov 2010]

Uniprot Description

BTN3A3: Plays a role in T-cell responses in the adaptive immune response. Belongs to the immunoglobulin superfamily. BTN/MOG family. Homodimer

Protein type: Membrane protein, integral; Cell surface

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: cytoplasm; Golgi apparatus; integral to membrane; membrane; nucleolus; plasma membrane

Biological Process: T cell mediated immunity

Research Articles on BTN3A3

Similar Products

Product Notes

The BTN3A3 btn3a3 (Catalog #AAA1001904) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-248aa; Extracellular Domain. The amino acid sequence is listed below: QFSVLGPSGP ILAMVGEDAD LPCHLFPTMS AETMELRWVS SSLRQVVNVY ADGKEVEDRQ SAPYRGRTSI LRDGITAGKA ALRIHNVTAS DSGKYLCYFQ DGDFYEKALV ELKVAALGSD LHIEVKGYED GGIHLECRST GWYPQPQIKW SDTKGENIPA VEAPVVADGV GLYAVAASVI MRGSSGGGVS CIIRNSLLGL EKTASISIAD PFFRSAQPW. It is sometimes possible for the material contained within the vial of "Butyrophilin subfamily 3 member A3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.