CD277 recombinant protein

CD277 Recombinant Protein

Cat. Num. AAA3016014

• Gene Names: BTN3A1; BTF5; BT3.1; CD277; BTN3.1
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Synonyms: CD277; CD277 Recombinant Protein; CD277 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Sequence: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

• Restriction Site: NdeI-XhoI
• Expression Vector: pet-22b(+)
• Preparation and Storage: Store at 4 degree C short term. Aliquot and store at -20 degree C long term. Avoid freeze-thaw cycles.

Testing Data

Related Product Information for CD277 recombinant protein

The Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) and CRISPR-associated protein (Cas9) system is an adaptive immune response defense mechanism used by archea and bacteria for the degradation of foreign genetic material. This mechanism can be repurposed for other functions, including genomic engineering for mammalian systems, such as gene knockout (KO) and gene activation. CRISPR Activation Plasmid products enable the identification and upregulation of specific genes by utilizing a D10A and N863A deactivated Cas9 (dCas9) nuclease fused to a VP64 activation domain, in conjunction with sgRNA (MS2), a target-specific sgRNA engineered to bind the MS2-P65-HSF1 fusion protein. This synergistic activation mediator (SAM) transcription activation system provides a robust system to maximize the activation of endogenous gene expression.

NCBI and Uniprot Product Information

• NCBI GI #: 117949374
• NCBI GeneID: 11119
• UniProt Accession #: O00481; Q0P515; Q147X5; Q53F15; Q99420; Q9HCY1; A2A278; A8K2C8; B4DIQ1; B4DRM2; E9PGB4; E9PHG8
• Molecular Weight: 52,019 Da
• NCBI Official Full Name: Butyrophilin subfamily 3 member A1
• NCBI Official Synonym Full Names: butyrophilin subfamily 3 member A1
• NCBI Official Symbol: BTN3A1
• NCBI Official Synonym Symbols: BTF5; BT3.1; CD277; BTN3.1
• NCBI Protein Information: butyrophilin subfamily 3 member A1
• UniProt Protein Name: Butyrophilin subfamily 3 member A1
• UniProt Gene Name: BTN3A1
• UniProt Synonym Gene Names: BTF5

NCBI Description

The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin (Ig) domains and an intracellular B30.2 (PRYSPRY) domain. Three subfamilies of human BTN genes are located in the MHC class I region: the single-copy BTN1A1 gene (MIM 601610) and the BTN2 (e.g., BTN2A1; MIM 613590) and BTN3 (e.g., BNT3A1) genes, which have undergone tandem duplication, resulting in 3 copies of each (summary by Smith et al., 2010 [PubMed 20208008]).[supplied by OMIM, Nov 2010]

Uniprot Description

Plays a role in T-cell activation and in the adaptive immune response. Regulates the proliferation of activated T-cells. Regulates the release of cytokines and IFNG by activated T-cells. Mediates the response of T-cells toward infected and transformed cells that are characterized by high levels of phosphorylated metabolites, such as isopentenyl pyrophosphate.