Biofilm regulator BssR (bssR) Recombinant Protein | bssR recombinant protein
Recombinant Escherichia coli Biofilm regulator BssR (bssR)
Gene Names
bssR; ECK0826; JW0820; yliH
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Biofilm regulator BssR (bssR); Recombinant Escherichia coli Biofilm regulator BssR (bssR); bssR recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-127, full length protein
Sequence
MFVDRQRIDLLNRLIDARVDLAAYVQLRKAKGYMSVSESNHLRDNFFKLNRELHDKSLRLNLHLDQEEWSALHHAEEALATAAVCLMSGHHDCPTVITVNADKLENCLMSLTLSIQSLQKHAMLEKA
Sequence Length
127
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14,536 Da
NCBI Official Full Name
repressor of biofilm formation by indole transport regulation
NCBI Official Symbol
bssR
NCBI Official Synonym Symbols
ECK0826; JW0820; yliH
NCBI Protein Information
repressor of biofilm formation by indole transport regulation
UniProt Protein Name
Biofilm regulator BssR
Protein Family
UniProt Gene Name
bssR
UniProt Synonym Gene Names
yliH
NCBI Description
Increases Mtr expression and indole import; decreases AcrEF expression and indole export. [More information is available at EcoGene: EG13479]. A bssR deletion mutant does not have a significant growth defect. [More information is available at EcoCyc: G6436].
Uniprot Description
Represses biofilm formation in M9C glu and LB glu media but not in M9C and LB media. Seems to act as a global regulator of several genes involved in catabolite repression and stress response and regulation of the uptake and export of signaling pathways. Could be involved the regulation of indole as well as uptake and export of AI-2 through a cAMP-dependent pathway.
Research Articles on bssR
Similar Products
Product Notes
The bssR bssr (Catalog #AAA1244244) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-127, full length protein. The amino acid sequence is listed below: MFVDRQRIDL LNRLIDARVD LAAYVQLRKA KGYMSVSESN HLRDNFFKLN RELHDKSLRL NLHLDQEEWS ALHHAEEALA TAAVCLMSGH HDCPTVITVN ADKLENCLMS LTLSIQSLQK HAMLEKA. It is sometimes possible for the material contained within the vial of "Biofilm regulator BssR (bssR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
