Protein bassoon (BSN) Recombinant Protein | BSN recombinant protein

Recombinant Human Protein bassoon (BSN) , partial

Cat. Num. AAA1336622

• Gene Names: BSN; ZNF231
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein bassoon (BSN); Recombinant Human Protein bassoon (BSN); partial; BSN recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1720-1812aa; Partial-length
• Sequence: AQEHTFLATATTVSITMASSVFMAQQKQPVVYGDPYQSRLDFGQGGGSPVCLAQVKQVEQAVQTAPYRSGPRGRPREAKFARYNLPNQVAPLA

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for BSN recombinant protein

Neurotransmitters are released from a specific site in the axon terminal called the active zone, which is composed of synaptic vesicles and a meshwork of cytoskeleton underlying the plasma membrane. This protein is thought to be a scaffolding protein involved in organizing the presynaptic cytoskeleton. The gene is expressed primarily in neurons in the brain. A similar gene product in rodents is concentrated in the active zone of axon terminals and tightly associated with cytoskeletal structures, and is essential for regulating neurotransmitter release from a subset of synapses.

NCBI and Uniprot Product Information

• NCBI GI #: 91208420
• NCBI GeneID: 8927
• NCBI Accession #: NP_003449.2
• NCBI GenBank Nucleotide #: NM_003458.3
• UniProt Accession #: Q9UPA5; O43161; Q7LGH3
• Molecular Weight: 416,469 Da
• NCBI Official Full Name: protein bassoon
• NCBI Official Synonym Full Names: bassoon presynaptic cytomatrix protein
• NCBI Official Symbol: BSN
• NCBI Official Synonym Symbols: ZNF231
• NCBI Protein Information: protein bassoon
• UniProt Protein Name: Protein bassoon
• Protein Family: Protein bassoon
• UniProt Gene Name: BSN
• UniProt Synonym Gene Names: KIAA0434; ZNF231

NCBI Description

Neurotransmitters are released from a specific site in the axon terminal called the active zone, which is composed of synaptic vesicles and a meshwork of cytoskeleton underlying the plasma membrane. The protein encoded by this gene is thought to be a scaffolding protein involved in organizing the presynaptic cytoskeleton. The gene is expressed primarily in neurons in the brain. A similar gene product in rodents is concentrated in the active zone of axon terminals and tightly associated with cytoskeletal structures, and is essential for regulating neurotransmitter release from a subset of synapses. [provided by RefSeq, Jul 2008]

Uniprot Description

Is thought to be involved in the organization of the cytomatrix at the nerve terminals active zone (CAZ) which regulates neurotransmitter release. Seems to act through binding to ERC2/CAST1. Essential in regulated neurotransmitter release from a subset of brain glutamatergic synapses. Involved in the formation of the retinal photoreceptor ribbon synapses ().