SDS-PAGE
BPI fold-containing family A member 2 (BPIFA2) Recombinant Protein | BPIFA2 recombinant protein
Recombinant Human BPI fold-containing family A member 2 (BPIFA2)
Gene Names
BPIFA2; PSP; SPLUNC2; C20orf70; bA49G10.1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
BPI fold-containing family A member 2 (BPIFA2); Recombinant Human BPI fold-containing family A member 2 (BPIFA2); Parotid secretory protein; BPIFA2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
19-249. Mature full length protein.
Sequence
ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI
Sequence Length
249
Species
Homo sapiens (Human)
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for BPIFA2 recombinant protein
Has strong antibacterial activity against P. aeruginosa.
Product Categories/Family for BPIFA2 recombinant protein
References
"A member of the PSP/plunc family of BPI proteins is expressed in the human parotid gland." Venkatesh S.G., Geetha C., Gorr S.-U. Submitted (OCT-2001)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25.1 kDa
NCBI Official Full Name
BPI fold-containing family A member 2
NCBI Official Synonym Full Names
BPI fold containing family A member 2
NCBI Official Symbol
BPIFA2
NCBI Official Synonym Symbols
PSP; SPLUNC2; C20orf70; bA49G10.1
NCBI Protein Information
BPI fold-containing family A member 2
UniProt Protein Name
BPI fold-containing family A member 2
Protein Family
UniProt Gene Name
BPIFA2
UniProt Synonym Gene Names
C20orf70; SPLUNC2; PSP
NCBI Description
This gene encodes a member of the palate, lung and nasal epithelium clone (Plunc) family of proteins. Members of this family have been proposed to play a role in the local antibacterial response in nose, mouth and upper respiratory pathways. The encoded soluble salivary protein binds bacterial lipopolysaccharide (LPS) and inhibits bacterial growth. This gene is present in a gene cluster on chromosome 20. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Uniprot Description
Has strong antibacterial activity against P. aeruginosa.
Research Articles on BPIFA2
Similar Products
Product Notes
The BPIFA2 bpifa2 (Catalog #AAA7053569) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-249. Mature full length protein. The amino acid sequence is listed below: ESLLDNLGND LSNVVDKLEP VLHEGLETVD NTLKGILEKL KVDLGVLQKS SAWQLAKQKA QEAEKLLNNV ISKLLPTNTD IFGLKISNSL ILDVKAEPID DGKGLNLSFP VTANVTVAGP IIGQIINLKA SLDLLTAVTI ETDPQTHQPV AVLGECASDP TSISLSLLDK HSQIINKFVN SVINTLKSTV SSLLQKEICP LIRIFIHSLD VNVIQQVVDN PQHKTQLQTL I . It is sometimes possible for the material contained within the vial of "BPI fold-containing family A member 2 (BPIFA2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
