BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like (BNIP3L) Recombinant Protein | BNIP3L recombinant protein
Recombinant Bovine BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like (BNIP3L)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like (BNIP3L); Recombinant Bovine BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like (BNIP3L); BNIP3L recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-219aa; full length protein
Sequence
MSSHLVEQPPPPHNNNNNCEEGEQSLPPPAGLNSSWVELPMNSSNGNDNGNGKNGGLEHV PSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSKDHSSQS EEEVAEGEKEVDALKKSVDWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMKKGGI FSAEFLKVFIPSLFLSHVLALGLGIYIGKRLSTPSASTY
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Bovine
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for BNIP3L recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23,846 Da
NCBI Official Full Name
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
NCBI Official Symbol
BNIP3L
NCBI Protein Information
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
UniProt Protein Name
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
Protein Family
UniProt Gene Name
BNIP3L
UniProt Entry Name
BNI3L_BOVIN
Uniprot Description
Induces apoptosis. Interacts with viral and cellular anti-apoptosis proteins. Can overcome the suppressors BCL-2 and BCL-XL, although high levels of BCL-XL expression will inhibit apoptosis. Inhibits apoptosis induced by BNIP3. Involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates in mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane regulates the opening of a pore in the mitochondrial double membrane in order to mediate the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix (). May function as a tumor suppressor ().
Similar Products
Product Notes
The BNIP3L bnip3l (Catalog #AAA7010440) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-219aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the BNIP3L bnip3l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSSHLVEQPP PPHNNNNNCE EGEQSLPPPA GLNSSWVELP MNSSNGNDNG NGKNGGLEHV PSSSSIHNGD MEKILLDAQH ESGQSSSRGS SHCDSPSPQE DGQIMFDVEM HTSKDHSSQS EEEVAEGEKE VDALKKSVDW VSDWSSRPEN IPPKEFHFRH PKRSVSLSMR KSGAMKKGGI FSAEFLKVFI PSLFLSHVLA LGLGIYIGKR LSTPSASTY. It is sometimes possible for the material contained within the vial of "BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like (BNIP3L), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
