BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 (Bnip2) Recombinant Protein | Bnip2 recombinant protein
Recombinant Mouse BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 (Bnip2)
Gene Names
Bnip2; Nip21; BNIP2beta; 5730523P12Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 (Bnip2); Recombinant Mouse BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 (Bnip2); Bnip2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-326, Full length protein
Sequence
MEGVELKEEWQDEDFPIPLPEDDSIEADTLDGTDPDRQPGSLEVNGNKVRKKLMAPDISLTLDPGEDSLWSDDLDEAGEVDLEGLDTPSENSDEFEWEDDLPKPKTTEVIRKGSITEYTATEEKGDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESGQPNYRYLMDNLFKYVIGTLELLVAENYMIIYLNGATTRRKMPSLGWLRRCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQYEEEKFKKRQKRVDQELNGKQEPPKSEQ
Sequence Length
326
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Bnip2 recombinant protein
This gene is a member of the BCL2
adenovirus E1B 19 kd-interacting protein (BNIP) family. Though the specific function is unknown, it interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector.
adenovirus E1B 19 kd-interacting protein (BNIP) family. Though the specific function is unknown, it interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37,769 Da
NCBI Official Full Name
BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 isoform beta
NCBI Official Synonym Full Names
BCL2/adenovirus E1B interacting protein 2
NCBI Official Symbol
Bnip2
NCBI Official Synonym Symbols
Nip21; BNIP2beta; 5730523P12Rik
NCBI Protein Information
BCL2/adenovirus E1B 19 kDa protein-interacting protein 2
UniProt Protein Name
BCL2/adenovirus E1B 19 kDa protein-interacting protein 2
Protein Family
UniProt Gene Name
Bnip2
UniProt Synonym Gene Names
Nip2l
Uniprot Description
Implicated in the suppression of cell death. Interacts with the BCL-2 and adenovirus E1B 19 kDa proteins ().
Research Articles on Bnip2
Similar Products
Product Notes
The Bnip2 bnip2 (Catalog #AAA1052484) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-326, Full length protein. The amino acid sequence is listed below: MEGVELKEEW QDEDFPIPLP EDDSIEADTL DGTDPDRQPG SLEVNGNKVR KKLMAPDISL TLDPGEDSLW SDDLDEAGEV DLEGLDTPSE NSDEFEWEDD LPKPKTTEVI RKGSITEYTA TEEKGDGRRW RMFRIGEQDH RVDMKAIEPY KKVISHGGYY GDGLNAIVVF AVCFMPESGQ PNYRYLMDNL FKYVIGTLEL LVAENYMIIY LNGATTRRKM PSLGWLRRCY QQIDRRLRKN LKSLIIVHPS WFIRTLLAVT RPFISSKFSQ KIRYVFNLAE LAELVPMEYV GIPECIKQYE EEKFKKRQKR VDQELNGKQE PPKSEQ. It is sometimes possible for the material contained within the vial of "BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 (Bnip2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
