Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Bone Morphogenetic Protein 3 (BMP3) Recombinant Protein | BMP3 recombinant protein

Recombinant Human Bone Morphogenetic Protein 3 (BMP3)

Gene Names
BMP3; BMP-3A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Bone Morphogenetic Protein 3 (BMP3); Recombinant Human Bone Morphogenetic Protein 3 (BMP3); Bone morphogenetic protein 3A; BMP-3A; Osteogenin; BMP3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Specificity
Expressed in adult and fetal cartilage.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
363-472aa; Full Length of Mature Protein
Sequence
QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
Sequence Length
472
Species
Human
Tag
C-terminal Myc-tagged
Subcellular Location
Secreted
Protein Families
TGF-beta family
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

SDS-Page
Related Product Information for BMP3 recombinant protein
Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification.
Product Categories/Family for BMP3 recombinant protein
References
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
651
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13.9 kDa
NCBI Official Full Name
bone morphogenetic protein 3 preproprotein
NCBI Official Synonym Full Names
bone morphogenetic protein 3
NCBI Official Symbol
BMP3
NCBI Official Synonym Symbols
BMP-3A
NCBI Protein Information
bone morphogenetic protein 3
UniProt Protein Name
Bone morphogenetic protein 3
UniProt Gene Name
BMP3
UniProt Synonym Gene Names
BMP3A; BMP-3; BMP-3A
UniProt Entry Name
BMP3_HUMAN

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein suppresses osteoblast differentiation, and negatively regulates bone density, by modulating TGF-beta receptor availability to other ligands. [provided by RefSeq, Jul 2016]

Uniprot Description

BMP3: Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. Belongs to the TGF-beta family.

Protein type: Secreted, signal peptide; Secreted; Cytokine

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: extracellular space

Molecular Function: growth factor activity; cytokine activity; transforming growth factor beta receptor binding; receptor binding

Biological Process: regulation of apoptosis; ossification; cell-cell signaling; regulation of MAPKKK cascade; cartilage development; positive regulation of transcription from RNA polymerase II promoter; skeletal development; cell development; growth

Research Articles on BMP3

Similar Products

Product Notes

The BMP3 bmp3 (Catalog #AAA7115187) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 363-472aa; Full Length of Mature Protein. The amino acid sequence is listed below: QWIEPRNCAR RYLKVDFADI GWSEWIISPK SFDAYYCSGA CQFPMPKSLK PSNHATIQSI VRAVGVVPGI PEPCCVPEKM SSLSILFFDE NKNVVLKVYP NMTVESCACR. It is sometimes possible for the material contained within the vial of "Bone Morphogenetic Protein 3 (BMP3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.