Bone morphogenetic protein 3 Recombinant Protein | BMP3 recombinant protein

Recombinant Human Bone morphogenetic protein 3

Cat. Num. AAA948539

• Gene Names: BMP3; BMP-3A
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Bone morphogenetic protein 3; Recombinant Human Bone morphogenetic protein 3; Bone morphogenetic protein 3A; BMP-3A; Osteogenin; BMP3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 363-472aa; Full Length
• Sequence: QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
• Sequence Length: 472

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for BMP3 recombinant protein

Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification.

Product Categories/Family for BMP3 recombinant protein

Developmental Biology

References

Novel regulators of bone formation molecular clones and activities.Wozney J.M., Rosen V., Celeste A.J., Mitsock L.M., Whitters M.J., Kriz R.W., Hewick R.M., Wang E.A.Science 242:1528-1534(1988) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005) Bone morphogenetic protein-3 is a negative regulator of bone density.Daluiski A., Engstrand T., Bahamonde M.E., Gamer L.W., Agius E., Stevenson S.L., Cox K., Rosen V., Lyons K.M.Nat. Genet. 27:84-88(2001) BMP signaling components are expressed in human fracture callus.Kloen P., Di Paola M., Borens O., Richmond J., Perino G., Helfet D.L., Goumans M.J.Bone 33:362-371(2003) Characterization of the distinct orthotopic bone-forming activity of 14 BMPs using recombinant adenovirus-mediated gene delivery.Kang Q., Sun M.H., Cheng H., Peng Y., Montag A.G., Deyrup A.T., Jiang W., Luu H.H., Luo J., Szatkowski J.P., Vanichakarn P., Park J.Y., Li Y., Haydon R.C., He T.-C.Gene Ther. 11:1312-1320(2004) Expression of bone morphogenetic proteins, receptors, and tissue inhibitors in human fetal, adult, and osteoarthritic articular cartilage.Chen A.L., Fang C., Liu C., Leslie M.P., Chang E., Di Cesare P.E.J. Orthop. Res. 22:1188-1192(2004) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) BMP-3 and BMP-6 structures illuminate the nature of binding specificity with receptors.Allendorph G.P., Isaacs M.J., Kawakami Y., Izpisua Belmonte J.C., Choe S.Biochemistry 46:12238-12247(2007)

NCBI and Uniprot Product Information

• NCBI GI #: 126507087
• NCBI GeneID: 651
• NCBI Accession #: NP_001192.2
• NCBI GenBank Nucleotide #: NM_001201.2
• UniProt Accession #: P12645; Q4VAS5
• Molecular Weight: 16.4 kDa
• NCBI Official Full Name: bone morphogenetic protein 3 preproprotein
• NCBI Official Synonym Full Names: bone morphogenetic protein 3
• NCBI Official Symbol: BMP3
• NCBI Official Synonym Symbols: BMP-3A
• NCBI Protein Information: bone morphogenetic protein 3
• UniProt Protein Name: Bone morphogenetic protein 3
• Protein Family: Bone morphogenetic protein
• UniProt Gene Name: BMP3
• UniProt Synonym Gene Names: BMP3A; BMP-3; BMP-3A
• UniProt Entry Name: BMP3_HUMAN

NCBI Description

BMP3 belongs to the transforming growth factor-beta (TGFB) superfamily. Bone morphogenic protein, also known as osteogenin, induces bone formation. [provided by RefSeq, Jul 2008]

Uniprot Description

BMP3: Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. Belongs to the TGF-beta family.

Protein type: Secreted; Secreted, signal peptide; Cytokine

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: extracellular space

Molecular Function: cytokine activity; growth factor activity; receptor binding; transforming growth factor beta receptor binding

Biological Process: BMP signaling pathway; cartilage development; cell development; cell-cell signaling; growth; osteoblast differentiation; positive regulation of transcription from RNA polymerase II promoter; regulation of apoptosis; regulation of MAPKKK cascade; skeletal development