SDS-PAGE
BH3-like motif-containing cell death inducer (BLID) Recombinant Protein | BLID recombinant protein
Recombinant Human BH3-like motif-containing cell death inducer (BLID)
Gene Names
BLID; BRCC2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
BH3-like motif-containing cell death inducer (BLID); Recombinant Human BH3-like motif-containing cell death inducer (BLID); BH3-like motif-containing cell death inducer; Breast cancer cell protein 2; BLID recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-108aa; Full Length
Sequence
MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL
Sequence Length
108
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for BLID recombinant protein
Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death.
Product Categories/Family for BLID recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39 kDa
NCBI Official Full Name
BH3-like motif-containing cell death inducer
NCBI Official Synonym Full Names
BH3-like motif containing, cell death inducer
NCBI Official Symbol
BLID
NCBI Official Synonym Symbols
BRCC2
NCBI Protein Information
BH3-like motif-containing cell death inducer; breast cancer cell 2; breast cancer cell protein 2
UniProt Protein Name
BH3-like motif-containing cell death inducer
Protein Family
UniProt Gene Name
BLID
UniProt Synonym Gene Names
BRCC2
UniProt Entry Name
BLID_HUMAN
NCBI Description
This gene encodes a BH3-like motif containing protein involved in cell death. The encoded protein may induce apoptosis in a caspase-dependent manner. The protein is localized in both the cytoplasm and the mitochondrion. [provided by RefSeq, Aug 2011]
Uniprot Description
BLID: Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death.
Protein type: Apoptosis; Mitochondrial
Chromosomal Location of Human Ortholog: 11q24.1
Cellular Component: mitochondrion
Biological Process: apoptosis
Research Articles on BLID
Similar Products
Product Notes
The BLID blid (Catalog #AAA1476577) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-108aa; Full Length. The amino acid sequence is listed below: MVTLLPIEGQ EIHFFEILES ECVLYTGWIE RASGSSIYPE AKARLPLEAL LGSNKEPMLP KETVLSLKRY NLGSSAMKRN VPGHVLQRPS YLTRIQVTLL CNSSAEAL. It is sometimes possible for the material contained within the vial of "BH3-like motif-containing cell death inducer (BLID), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
