Beta-lactamase TEM (bla) Recombinant Protein | bla recombinant protein

Recombinant Escherichia coli Beta-lactamase TEM (bla)

Cat. Num. AAA1262737

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Beta-lactamase TEM (bla); Recombinant Escherichia coli Beta-lactamase TEM (bla); IRT-4; Penicillinase; TEM-1; TEM-16/CAZ-7; TEM-2; TEM-24/CAZ-6; TEM-3; TEM-4; TEM-5; TEM-6; TEM-8/CAZ-2; bla recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 24-286aa;Full Length of Mature Protein
• Sequence: HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

• Production Note: Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for bla recombinant protein

T-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. T-3 and T-4 are capable of hydrolyzing cefotaxime and ceftazidime. T-5 is capable of hydrolyzing ceftazidime. T-6 is capable of hydrolyzing ceftazidime and aztreonam. T-8/CAZ-2, T-16/CAZ-7 and T-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors.

References

Nucleotide sequence of the ampicillin resistance gene of Escherichia coli plasmid pBR322.Sutcliffe J.G.Proc. Natl. Acad. Sci. U.S.A. 75:3737-3741(1978) Complete nucleotide sequence of the Escherichia coli plasmid pBR322.Sutcliffe J.G.Cold Spring Harb. Symp. Quant. Biol. 43:77-90(1979) DNA replication of the resistance plasmid R100 and its control.Ohtsubo H., Ryder T.B., Maeda Y., Armstrong K., Ohtsubo E.Adv. Biophys. 21:115-133(1986) Partial amino acid sequence of penicillinase coded by Escherichia coli plasmid R6K.Ambler R.P., Scott G.K.Proc. Natl. Acad. Sci. U.S.A. 75:3732-3736(1978) The TEM-3 beta-lactamase, which hydrolyzes broad-spectrum cephalosporins, is derived from the TEM-2 penicillinase by two amino acid substitutions.Sougakoff W., Goussard S., Courvalin P.FEMS Microbiol. Lett. 56:343-348(1988) A new example of physical linkage between Tn1 and Tn21 the antibiotic multiple-resistance region of plasmid pCFF04 encoding extended-spectrum beta-lactamase TEM-3.Mabilat C., Lourencao-Vital J., Goussard S., Courvalin P.Mol. Gen. Genet. 235:113-121(1992) Characterization of the plasmid genes blaT-4 and blaT-5 which encode the broad-spectrum beta-lactamases TEM-4 and TEM-5 in enterobacteriaceae.Sougakoff W., Petit A., Goussard S., Sirot D., Bure A., Courvalin P.Gene 78:339-348(1989) An IS1-like element is responsible for high-level synthesis of extended-spectrum beta-lactamase TEM-6 in Enterobacteriaceae.Goussard S., Sougakoff W., Mabilat C., Bauernfeind A., Courvalin P.J. Gen. Microbiol. 137:2681-2687(1991) Nucleotide sequences of CAZ-2, CAZ-6, and CAZ-7 beta-lactamase genes.Chanal C., Poupart M.C., Sirot D., Labia R., Sirot J., Cluzel R.Antimicrob. Agents Chemother. 36:1817-1820(1992) Characterization and amino acid sequence of IRT-4, a novel TEM-type enzyme with a decreased susceptibility to beta-lactamase inhibitors.Brun T., Peduzzi J., Canica M.M., Paul G., Nevot P., Barthelemy M., Labia R.FEMS Microbiol. Lett. 120:111-117(1994) Beta-lactamase TEM1 of E. coli. Crystal structure determination at 2.5-A resolution.Jelsch C., Lenfant F., Masson J.-M., Samama J.-P.FEBS Lett. 299:135-142(1992) Crystal structure of Escherichia coli TEM1 beta-lactamase at 1.8-A resolution.Jelsch C., Mourey L., Masson J.-M., Samama J.-P.Proteins 16:364-383(1993) A potent new mode of beta-lactamase inhibition revealed by the 1.7 A X-ray crystallographic structure of the TEM-1-BLIP complex.Strynadka N.C.J., Jensen S.E., Alzari P.M., James M.N.G.Nat. Struct. Biol. 3:290-297(1996) Crystal structure of an acylation transition-state analog of the TEM-1 beta-lactamase. Mechanistic implications for class A beta-lactamases.Maveyraud L., Pratt R.F., Samama J.-P.Biochemistry 37:2622-2628(1998) X-ray structure of the Asn276Asp variant of the Escherichia coli TEM-1 beta-lactamase direct observation of electrostatic modulation in resistance to inactivation by clavulanic acid.Swaren P., Golemi D., Cabantous S., Bulychev A., Maveyraud L., Mobashery S., Samama J.-P.Biochemistry 38:9570-9576(1999)

NCBI and Uniprot Product Information

• NCBI GI #: 38638187
• NCBI GeneID: 3722457
• NCBI Accession #: NP_943295.1
• NCBI GenBank Nucleotide #: NC_005248.1
• UniProt Accession #: P62593; P00810; Q47313
• Molecular Weight: 30.9 kDa
• NCBI Official Full Name: beta-lactamase (plasmid)
• NCBI Official Symbol: pIGAL1_03
• NCBI Protein Information: beta-lactamase
• UniProt Protein Name: Beta-lactamase TEM
• Protein Family: Beta-lactamase
• UniProt Gene Name: bla
• UniProt Entry Name: BLAT_ECOLX

Uniprot Description

TEM-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 are capable of hydrolyzing cefotaxime and ceftazidime. TEM-5 is capable of hydrolyzing ceftazidime. TEM-6 is capable of hydrolyzing ceftazidime and aztreonam. TEM-8/CAZ-2, TEM-16/CAZ-7 and TEM-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors.