Baculoviral IAP repeat-containing protein 5 (BIRC5) Recombinant Protein | BIRC5 recombinant protein

Recombinant Cat Baculoviral IAP repeat-containing protein 5 (BIRC5)

Cat. Num. AAA1484128

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Baculoviral IAP repeat-containing protein 5 (BIRC5); Recombinant Cat Baculoviral IAP repeat-containing protein 5 (BIRC5); BIRC5 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-142, full length protein
• Sequence: MGASSLPPAWQLYLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLSEFLKLDKERAKNKIAKETNHKQKEFEETAKRVRCAIEQLAALE
• Sequence Length: 142

• Species: Felis catus (Cat) (Felis silvestris catus)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for BIRC5 recombinant protein

This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors yet low in adult tissues. Antisense transcripts are involved in the regulation of this gene s expression. At least four transcript variants encoding distinct isoforms have been found for this gene, but the full-length natures of only three of them have been determined.

NCBI and Uniprot Product Information

• NCBI GI #: 57163813
• NCBI GeneID: 493835
• NCBI Accession #: NP_001009280.1
• NCBI GenBank Nucleotide #: NM_001009280.1
• UniProt Accession #: Q6I6F4
• Molecular Weight: 16,393 Da
• NCBI Official Full Name: baculoviral IAP repeat-containing protein 5
• NCBI Official Symbol: BIRC5
• NCBI Protein Information: baculoviral IAP repeat-containing protein 5
• UniProt Protein Name: Baculoviral IAP repeat-containing protein 5
• Protein Family: Baculoviral IAP repeat-containing protein
• UniProt Gene Name: BIRC5

Uniprot Description

Multitasking protein that has dual roles in promoting cell proliferation and preventing apoptosis. Component of a chromosome passage protein complex (CPC) which is essential for chromosome alignment and segregation during mitosis and cytokinesis. Acts as an important regulator of the localization of this complex; directs CPC movement to different locations from the inner centromere during prometaphase to midbody during cytokinesis and participates in the organization of the center spindle by associating with polymerized microtubules. Involved in the recruitment of CPC to centromeres during early mitosis via association with histone H3 phosphorylated at 'Thr-3' (H3pT3) during mitosis. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May counteract a default induction of apoptosis in G2/M phase. The acetylated form represses STAT3 transactivation of target gene promoters. May play a role in neoplasia. Inhibitor of CASP3 and CASP7.