Translocator protein BipB (bipB) Recombinant Protein | bipB recombinant protein
Recombinant Burkholderia pseudomallei Translocator protein BipB (bipB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Translocator protein BipB (bipB); Recombinant Burkholderia pseudomallei Translocator protein BipB (bipB); bipB recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-620aa; full length protein
Sequence
MSSGVQGGPAANANAYQTHPLRDAASALGTLSPQAYVDVVSAAQRNFLERMSQLASEQCD AQPAAHDARLDDRPALRAPQERDAPPLGASDTGSRASGAAKLTELLGVLMSVISASSLDE LKQRSDIWNQMSKAAQDNLSRLSDAFQRATDEAKAAADAAEQAAAAAKQAGADAKAADAA VDAAQKRYDDAVKQGLPDDRLQSLKAALEQARQQAGDAHGRADALQADATKKLDAASALA TQARACEQQVDDAVNQATQQYGASASLRTPQSPRLSGAAELTAVLGKLQELISSGNVKEL ESKQKLFTEMQAKREAELQKKSDEYQAQVKKAEEMQKTMGCIGKIVGWVITAVSFAAAAF TGGASLALAAVGLALAVGDEISRATTGVSFMDKLMQPVMDAILKPLMEMISSLITKALVA CGVDQQKAELAGAILGAVVTGVALVAAAFVGASAVKAVASKVIDAMAGQLTKLMDSAIGK MLVQLIEKFSEKSGLQALGSRTATAMTRMRRAIGVEAKEDGMLLANRFEKAGTVMNVGNQ VSQAAGGIVVGVERAKAMGLLADVKEAMYDIKLLGDLLKQAVDAFAEHNRVLAQLMQQMS DAGEMQTSTGKLILRNARAV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Burkholderia pseudomallei (strain K96243)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for bipB recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,680 Da
NCBI Official Full Name
MULTISPECIES: translocator protein BipB
NCBI Official Symbol
bipB
NCBI Protein Information
cell invasion protein
UniProt Protein Name
Translocator protein BipB
Protein Family
UniProt Gene Name
bipB
UniProt Entry Name
BIPB_BURPS
Uniprot Description
Plays a role in the bacterium-induced formation of multinucleated giant cell (MNGC), which is formed after host cell fusion, as well as in the intercellular spreading of bacteria and in the induction of apoptosis in macrophages. May act in concert with other effector proteins to induce fusion of host cell membranes.
Similar Products
Product Notes
The bipB bipb (Catalog #AAA7010416) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-620aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the bipB bipb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSSGVQGGPA ANANAYQTHP LRDAASALGT LSPQAYVDVV SAAQRNFLER MSQLASEQCD AQPAAHDARL DDRPALRAPQ ERDAPPLGAS DTGSRASGAA KLTELLGVLM SVISASSLDE LKQRSDIWNQ MSKAAQDNLS RLSDAFQRAT DEAKAAADAA EQAAAAAKQA GADAKAADAA VDAAQKRYDD AVKQGLPDDR LQSLKAALEQ ARQQAGDAHG RADALQADAT KKLDAASALA TQARACEQQV DDAVNQATQQ YGASASLRTP QSPRLSGAAE LTAVLGKLQE LISSGNVKEL ESKQKLFTEM QAKREAELQK KSDEYQAQVK KAEEMQKTMG CIGKIVGWVI TAVSFAAAAF TGGASLALAA VGLALAVGDE ISRATTGVSF MDKLMQPVMD AILKPLMEMI SSLITKALVA CGVDQQKAEL AGAILGAVVT GVALVAAAFV GASAVKAVAS KVIDAMAGQL TKLMDSAIGK MLVQLIEKFS EKSGLQALGS RTATAMTRMR RAIGVEAKED GMLLANRFEK AGTVMNVGNQ VSQAAGGIVV GVERAKAMGL LADVKEAMYD IKLLGDLLKQ AVDAFAEHNR VLAQLMQQMS DAGEMQTSTG KLILRNARAV. It is sometimes possible for the material contained within the vial of "Translocator protein BipB (bipB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
