Probable biotin transporter BioY (bioY) Recombinant Protein | PH0159 recombinant protein
Recombinant Pyrococcus horikoshii Probable biotin transporter BioY (bioY)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable biotin transporter BioY (bioY); Recombinant Pyrococcus horikoshii Probable biotin transporter BioY (bioY); PH0159 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-162
Sequence
MKAKEVSLVALFVALTSVGAQISVSIGPVPLTLQVFFVILAGLVLGPKLGFLSILIYDILGALGIPVFAGFSGGIAHILGPTGGYIIAFPIATFIAGLGRGKVRYLTSLMGLLVIYLIGWMWLARFVGFNKAFILGVLPFIVPDIVKAATAVIIAERLQGNT
Sequence Length
162
Species
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for PH0159 recombinant protein
bioY
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,000 Da
NCBI Official Full Name
hypothetical protein PH0159
NCBI Official Symbol
PH0159
NCBI Protein Information
hypothetical protein
UniProt Protein Name
Probable biotin transporter BioY
UniProt Gene Name
bioY
UniProt Entry Name
BIOY_PYRHO
Uniprot Description
Function: Probable biotin transporter
By similarity.
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the BioY family.
Similar Products
Product Notes
The PH0159 bioy (Catalog #AAA1087797) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-162. The amino acid sequence is listed below: MKAKEVSLVA LFVALTSVGA QISVSIGPVP LTLQVFFVIL AGLVLGPKLG FLSILIYDIL GALGIPVFAG FSGGIAHILG PTGGYIIAFP IATFIAGLGR GKVRYLTSLM GLLVIYLIGW MWLARFVGFN KAFILGVLPF IVPDIVKAAT AVIIAERLQG NT. It is sometimes possible for the material contained within the vial of "Probable biotin transporter BioY (bioY), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
