Neurogenic protein big brain (bib) Recombinant Protein | bib recombinant protein
Recombinant Drosophila melanogaster Neurogenic protein big brain (bib)
Gene Names
bib; Bib; BIB_DROME; CG4722; DmelCG4722; EP(2)2278; l(2)neo66; l(2)neo91; m-bib
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neurogenic protein big brain (bib); Recombinant Drosophila melanogaster Neurogenic protein big brain (bib); bib recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-696aa; full length protein
Sequence
MADESLHTVPLEHNIDYHIVTLFERLEAMRKDSHGGGHGVNNRLSSTLQAPKRSMQAEIR TLEFWRSIISECLASFMYVFIVCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLHI SGAHINPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISH SAALAAWERFGVEFILTFLVVLCYFVSTDPMKKFMGNSAASIGCAYSACCFVSMPYLNPA RSLGPSFVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSRNRNLRHNKGSIDNDSSSIHS EDELNYDMDMEKPNKYQQSQGTYPRGQSNGNGGGQAAGNGQHQAANMGQMPGVVANAGQG NYCQNLYTAPPLSSKYDQQQEPLYGGTRSLYCRSPTLTRSNLNRSQSVYAKSNTAINRDI VPRPGPLVPAQSLYPMRTQQQQQQQQQQQQQVAPAPQSSHLQNQNVQNQMQQRSESIYGM RGSMRGQQQPIQQQQQQQQQQQLQQQQPNMGVQQQQMQPPPQMMSDPQQQPQGFQPVYGT RTNPTPMDGNHKYDRRDPQQMYGVTGPRNRGQSAQSDDSSYGSYHGSAVTPPARHPSVEP SPPPPPMLMYAPPPQPNAAHPQPIRTQSERKVSAPVVVSQPAACAVTYTTSQGSAVTAQQ QQQQQQQQQQQQQQQQQQMMMQQQQQHYGMLPLRPN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for bib recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
76,509 Da
NCBI Official Full Name
big brain, isoform A
NCBI Official Synonym Full Names
big brain
NCBI Official Symbol
bib
NCBI Official Synonym Symbols
Bib; BIB_DROME; CG4722; DmelCG4722; EP(2)2278; l(2)neo66; l(2)neo91; m-bib
NCBI Protein Information
CG4722 gene product from transcript CG4722-RA
UniProt Protein Name
Neurogenic protein big brain
Protein Family
UniProt Gene Name
bib
UniProt Entry Name
BIB_DROME
Uniprot Description
Essential for proper differentiation of ectoderm. Acts synergistically with neurogenic locus proteins Notch and Delta during the separation of neural and epidermal cell lineages in response to the lateral inhibition signal. Voltage-insensitive monovalent cation channel. Ion transport is blocked by the presence of divalent cations.
Research Articles on bib
Similar Products
Product Notes
The bib bib (Catalog #AAA7010395) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-696aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the bib bib for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MADESLHTVP LEHNIDYHIV TLFERLEAMR KDSHGGGHGV NNRLSSTLQA PKRSMQAEIR TLEFWRSIIS ECLASFMYVF IVCGAAAGVG VGASVSSVLL ATALASGLAM ATLTQCFLHI SGAHINPAVT LALCVVRSIS PIRAAMYITA QCGGGIAGAA LLYGVTVPGY QGNLQAAISH SAALAAWERF GVEFILTFLV VLCYFVSTDP MKKFMGNSAA SIGCAYSACC FVSMPYLNPA RSLGPSFVLN KWDSHWVYWF GPLVGGMASG LVYEYIFNSR NRNLRHNKGS IDNDSSSIHS EDELNYDMDM EKPNKYQQSQ GTYPRGQSNG NGGGQAAGNG QHQAANMGQM PGVVANAGQG NYCQNLYTAP PLSSKYDQQQ EPLYGGTRSL YCRSPTLTRS NLNRSQSVYA KSNTAINRDI VPRPGPLVPA QSLYPMRTQQ QQQQQQQQQQ QVAPAPQSSH LQNQNVQNQM QQRSESIYGM RGSMRGQQQP IQQQQQQQQQ QQLQQQQPNM GVQQQQMQPP PQMMSDPQQQ PQGFQPVYGT RTNPTPMDGN HKYDRRDPQQ MYGVTGPRNR GQSAQSDDSS YGSYHGSAVT PPARHPSVEP SPPPPPMLMY APPPQPNAAH PQPIRTQSER KVSAPVVVSQ PAACAVTYTT SQGSAVTAQQ QQQQQQQQQQ QQQQQQQQMM MQQQQQHYGM LPLRPN. It is sometimes possible for the material contained within the vial of "Neurogenic protein big brain (bib), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
