Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cytochrome b mRNA maturase bI2 (bI2) Recombinant Protein | BI2 recombinant protein

Recombinant Saccharomyces cerevisiae Cytochrome b mRNA maturase bI2 (bI2)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome b mRNA maturase bI2 (bI2); Recombinant Saccharomyces cerevisiae Cytochrome b mRNA maturase bI2 (bI2); Recombinant Cytochrome b mRNA maturase bI2 (bI2); Cytochrome b mRNA maturase bI2; BI2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-423
Sequence
MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIELAFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVIIFILTIATAFLGYCCVYGQMSHWGNMNIASNMFNMMKTIYMMMLMLLIYIFYTIMMRQMMKTKEYTMLIKSMDYINKNKYMINLNMTNKKDMNNNIGPLNMNILSIIYGSMLGDGHAEKRKGGKGTRIVFQQEYCNINYLYYLHSLLANLGYCNTNLPLIKTRLGKKGKIRQYLKFNTWTYDSFNMIYSEWYIKNMSGKGNIKVIPKSLDNYLTPLALAIWIMDDGCKLGKGLKFTTNCFSYKDVQYLTYLLHNKYNIKSTITKGNKENTQFVIYVWKESMPILTKIVSPYIIPSMKYKLGNYL
Sequence Length
423
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,326 Da
NCBI Official Full Name
Mitochondrial mRNA maturase with a role in splicing, encoded by both exon and intron sequences of partially processed COB mRNA
NCBI Official Symbol
BI2
NCBI Protein Information
Bi2p; Mitochondrial mRNA maturase with a role in splicing, encoded by both exon and intron sequences of partially processed COB mRNA
UniProt Protein Name
Cytochrome b mRNA maturase bI2
UniProt Gene Name
bI2
UniProt Entry Name
MBI2_YEAST

Uniprot Description

Function: This protein is responsible for splicing and maturation of cytochrome b mRNA. Specifically, it may be responsible for the splicing specificity of the second intron. Ref.3 Ref.4 Ref.5

Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein

Potential.

Polymorphism: The variant in strain Capensis / YB4237 has additional DNA endonuclease (I-ScaI) activity promoting intron homing, which makes intron 2 of the COB gene highly mobile. Introduction of 2 (Ala-355 and His-382) of its 4 variant residues into other strains is sufficient for acquisition of endonuclease activity of the corresponding mRNA maturases and for induction of intron mobility.

Miscellaneous: Encoded from partially processed COB mRNA that terminates with the in-frame coding sequence of the second intron.

Sequence similarities: In the N-terminal section; belongs to the cytochrome b family.In the C-terminal section; belongs to the LAGLIDADG endonuclease family.

Similar Products

Product Notes

The BI2 bi2 (Catalog #AAA1075700) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-423. The amino acid sequence is listed below: MAFRKSNVYL SLVNSYIIDS PQPSSINYWW NMGSLLGLCL VIQIVTGIFM AMHYSSNIEL AFSSVEHIMR DVHNGYILRY LHANGASFFF MVMFMHMAKG LYYGSYRSPR VTLWNVGVII FILTIATAFL GYCCVYGQMS HWGNMNIASN MFNMMKTIYM MMLMLLIYIF YTIMMRQMMK TKEYTMLIKS MDYINKNKYM INLNMTNKKD MNNNIGPLNM NILSIIYGSM LGDGHAEKRK GGKGTRIVFQ QEYCNINYLY YLHSLLANLG YCNTNLPLIK TRLGKKGKIR QYLKFNTWTY DSFNMIYSEW YIKNMSGKGN IKVIPKSLDN YLTPLALAIW IMDDGCKLGK GLKFTTNCFS YKDVQYLTYL LHNKYNIKST ITKGNKENTQ FVIYVWKESM PILTKIVSPY IIPSMKYKLG NYL. It is sometimes possible for the material contained within the vial of "Cytochrome b mRNA maturase bI2 (bI2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.