Cryptic outer membrane porin BglH (bglH) Recombinant Protein | bglH recombinant protein
Recombinant Escherichia coli Cryptic outer membrane porin BglH (bglH)
Gene Names
bglH; ECK3713; JW3698; yieC
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cryptic outer membrane porin BglH (bglH); Recombinant Escherichia coli Cryptic outer membrane porin BglH (bglH); bglH recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-538, full length protein
Sequence
ESLTVEQRLELLEKALRETQSELKKYKDEEKKKYTPATVNRSVSTNDQGYAANPFPTSSAAKPDAVLVKNEEKNASETGSIYSSMTLKDFSKFVKDEIGFSYNGYYRSGWGTASHGSPKSWAIGSLGRFGNEYSGWFDLQLKQRVYNENGKRVDAVVMMDGNVGQQYSTGWFGDNAGGENYMQFSDMYVTTKGFLPFAPEADFWVGKHGAPKIEIQMLDWKTQRTDAAAGVGLENWKVGPGKIDIALVREDVDDYDRSLQNKQQINTNTIDLRYKDIPLWDKATLMVSGRYVTANESASEKDNQDNNGYYDWKDTWMFGTSLTQKFDKGGFNEFSFLVANNSIASNFGRYAGASPFTTFNGRYYGDHTGGTAVRLTSQGEAYIGDHFIVANAIVYSFGNDIYSYETGAHSDFESIRAVVRPAYIWDQYNQTGVELGYFTQQNKDANSNKFNESGYKTTLFHTFKVNTSMLTSRPEIRFYATYIKALENELDGFTFEDNKDDQFAVGAQAEIWW
Sequence Length
513
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60,657 Da
NCBI Official Full Name
carbohydrate-specific outer membrane porin, cryptic
NCBI Official Symbol
bglH
NCBI Official Synonym Symbols
ECK3713; JW3698; yieC
NCBI Protein Information
carbohydrate-specific outer membrane porin, cryptic
UniProt Protein Name
Cryptic outer membrane porin BglH
Protein Family
UniProt Gene Name
bglH
UniProt Synonym Gene Names
yieC
NCBI Description
This carbohydrate-specific porin preferentially binds arbutin, salicin and cellobiose. bglH is part of the cryptic bglGFBH operon. [More information is available at EcoGene: EG11364]. BghL is an outer-membrane porin coded for by a gene in the cryptic bgl operon. [More information is available at EcoCyc: EG11364].
Uniprot Description
Part of a cryptic operon that is poorly expressed in vivo. May be an ancestral sugar porin with a broad carbohydrate specificity; it binds aromatic beta-D-glucosides such as arbutin and salicin, but with low affinity compared to the binding of maltooligosaccharides to the LamB porin.
Similar Products
Product Notes
The bglH bglh (Catalog #AAA1104851) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-538, full length protein. The amino acid sequence is listed below: ESLTVEQRLE LLEKALRETQ SELKKYKDEE KKKYTPATVN RSVSTNDQGY AANPFPTSSA AKPDAVLVKN EEKNASETGS IYSSMTLKDF SKFVKDEIGF SYNGYYRSGW GTASHGSPKS WAIGSLGRFG NEYSGWFDLQ LKQRVYNENG KRVDAVVMMD GNVGQQYSTG WFGDNAGGEN YMQFSDMYVT TKGFLPFAPE ADFWVGKHGA PKIEIQMLDW KTQRTDAAAG VGLENWKVGP GKIDIALVRE DVDDYDRSLQ NKQQINTNTI DLRYKDIPLW DKATLMVSGR YVTANESASE KDNQDNNGYY DWKDTWMFGT SLTQKFDKGG FNEFSFLVAN NSIASNFGRY AGASPFTTFN GRYYGDHTGG TAVRLTSQGE AYIGDHFIVA NAIVYSFGND IYSYETGAHS DFESIRAVVR PAYIWDQYNQ TGVELGYFTQ QNKDANSNKF NESGYKTTLF HTFKVNTSML TSRPEIRFYA TYIKALENEL DGFTFEDNKD DQFAVGAQAE IWW. It is sometimes possible for the material contained within the vial of "Cryptic outer membrane porin BglH (bglH), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
