Osteocalcin Recombinant Protein | BGLAP recombinant protein

Recombinant Human Osteocalcin

Cat. Num. AAA967148

• Gene Names: BGLAP; OC; BGP; OCN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Synonyms: Osteocalcin; Recombinant Human Osteocalcin; Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein; BGLAP recombinant protein

• Host: E Coli
• Purity/Purification: Greater than 90% as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 52-100
• Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
• Sequence Length: 100

• Product Note: Applications are user defined. Product is developed and quality control tested in house, data or additional information may be provided upon request. The researcher needs to establish and confirm the suitability of the product for their application.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for BGLAP recombinant protein

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

Product Categories/Family for BGLAP recombinant protein

Metabolism; Raw Materials Assay Development

References

The cDNA and derived amino acid sequences of human and bovine bone Gla protein.Kiefer M.C., Saphire A.C.S., Bauer D.M., Barr P.J.Nucleic Acids Res. 18:1909-1909(1990) Isolation of the human gene for bone gla protein utilizing mouse and rat cDNA clones.Celeste A.J., Buecker J.L., Kriz R., Wang E.A., Wozney J.M.EMBO J. 5:1885-1890(1986) SeattleSNPs variation discovery resourceThe DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006)

NCBI and Uniprot Product Information

• NCBI GI #: 40316933
• NCBI GeneID: 632
• NCBI Accession #: NP_954642.1
• NCBI GenBank Nucleotide #: NM_199173.5
• UniProt Accession #: P02818; Q5TCK6
• Molecular Weight: 33.2kD
• NCBI Official Full Name: osteocalcin preproprotein
• NCBI Official Synonym Full Names: bone gamma-carboxyglutamate (gla) protein
• NCBI Official Symbol: BGLAP
• NCBI Official Synonym Symbols: OC; BGP; OCN
• NCBI Protein Information: osteocalcin
• UniProt Protein Name: Osteocalcin
• Protein Family: Osteocalcin
• UniProt Gene Name: BGLAP
• UniProt Synonym Gene Names: BGP
• UniProt Entry Name: OSTCN_HUMAN

NCBI Description

This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. [provided by RefSeq, Jun 2015]

Uniprot Description

osteocalcin: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Belongs to the osteocalcin/matrix Gla protein family.

Protein type: Cell development/differentiation; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: cytoplasm; endoplasmic reticulum lumen; Golgi lumen

Biological Process: ER to Golgi vesicle-mediated transport; osteoblast differentiation; peptidyl-glutamic acid carboxylation; response to vitamin D; signal peptide processing; skeletal development