Osteocalcin Recombinant Protein | Bglap recombinant protein

Recombinant Rat Osteocalcin

Cat. Num. AAA1058077

• Gene Names: Bglap; Bgp; Bgpr; Bgpra; Bglap2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Osteocalcin; Recombinant Rat Osteocalcin; Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein; Bglap recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 50-99aa; Full Length of Mature Protein
• Sequence: YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV
• Sequence Length: 99

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for Bglap recombinant protein

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

References

Isolation of the human gene for bone gla protein utilizing mouse and rat cDNA clones.Celeste A.J., Buecker J.L., Kriz R., Wang E.A., Wozney J.M.EMBO J. 5:1885-1890(1986) The propeptide of rat bone gamma-carboxyglutamic acid protein shares homology with other vitamin K-dependent protein precursors.Pan L.C., Price P.A.Proc. Natl. Acad. Sci. U.S.A. 82:6109-6113(1985) Characterization of the rat osteocalcin gene stimulation of promoter activity by 1,25-dihydroxyvitamin D3.Yoon K., Rutledge S.J.C., Buenaga R.F., Rodan G.A.Biochemistry 27:8521-8526(1988) Molecular structure of the rat bone Gla protein gene and identification of putative regulatory elements.Theofan G., Haberstroh L.M., Price P.A.DNA 8:213-221(1989) Structure of the rat osteocalcin gene and regulation of vitamin D-dependent expression.Lian J., Stewart C., Puchacz E., Mackowiak S., Shalhoub V., Collart D., Zambetti G., Stein G.Proc. Natl. Acad. Sci. U.S.A. 86:1143-1147(1989)

NCBI and Uniprot Product Information

• NCBI GI #: 11761543
• NCBI GeneID: 25295
• NCBI Accession #: NP_038200.1
• NCBI GenBank Nucleotide #: NM_013414.1
• UniProt Accession #: P04640
• Molecular Weight: 32.6 kDa
• NCBI Official Full Name: osteocalcin preproprotein
• NCBI Official Synonym Full Names: bone gamma-carboxyglutamate (gla) protein
• NCBI Official Symbol: Bglap
• NCBI Official Synonym Symbols: Bgp; Bgpr; Bgpra; Bglap2
• NCBI Protein Information: osteocalcin
• UniProt Protein Name: Osteocalcin
• Protein Family: Osteocalcin
• UniProt Gene Name: Bglap
• UniProt Synonym Gene Names: Bglap2; BGP
• UniProt Entry Name: OSTCN_RAT

NCBI Description

highly conserved protein associated with mineralized bone matrix; protein is secreted by calcified tissues and is regulated by vitamin D3 [RGD, Feb 2006]

Uniprot Description

osteocalcin: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Belongs to the osteocalcin/matrix Gla protein family.

Protein type: Secreted; Secreted, signal peptide; Cell development/differentiation

Cellular Component: cell projection; cytoplasm; dendrite; extracellular region; extracellular space; Golgi apparatus; perikaryon; rough endoplasmic reticulum

Molecular Function: calcium ion binding; structural constituent of bone

Biological Process: aging; biomineral formation; cell aging; odontogenesis; ossification; osteoblast development; osteoblast differentiation; regulation of bone mineralization; response to activity; response to drug; response to estrogen stimulus; response to ethanol; response to glucocorticoid stimulus; response to gravity; response to hydroxyisoflavone; response to inorganic substance; response to mechanical stimulus; response to nutrient levels; response to organic cyclic substance; response to testosterone stimulus; response to vitamin D; response to vitamin K; response to zinc ion