Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Apoptosis facilitator Bcl-2-like protein 14 (BCL2L14) Recombinant Protein | BCL2L14 recombinant protein

Recombinant Human Apoptosis facilitator Bcl-2-like protein 14 (BCL2L14)

Gene Names
BCL2L14; BCLG
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apoptosis facilitator Bcl-2-like protein 14 (BCL2L14); Recombinant Human Apoptosis facilitator Bcl-2-like protein 14 (BCL2L14); Apoptosis facilitator Bcl-2-like protein 14; Bcl2-L-14; Apoptosis regulator Bcl-G; BCL2L14 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-327aa; Full Length
Sequence
MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD
Sequence Length
327
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for BCL2L14 recombinant protein
Plays a role in apoptosis.
Product Categories/Family for BCL2L14 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63.6 kDa
NCBI Official Full Name
apoptosis facilitator Bcl-2-like protein 14 isoform 2
NCBI Official Synonym Full Names
BCL2-like 14 (apoptosis facilitator)
NCBI Official Symbol
BCL2L14
NCBI Official Synonym Symbols
BCLG
NCBI Protein Information
apoptosis facilitator Bcl-2-like protein 14; bcl2-L-14; apoptosis regulator BCL-G
UniProt Protein Name
Apoptosis facilitator Bcl-2-like protein 14
UniProt Gene Name
BCL2L14
UniProt Synonym Gene Names
BCLG; Bcl2-L-14
UniProt Entry Name
B2L14_HUMAN

NCBI Description

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Overexpression of this gene has been shown to induce apoptosis in cells. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported for this gene. [provided by RefSeq, May 2009]

Uniprot Description

Bcl-G: Plays a role in apoptosis. Belongs to the Bcl-2 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 12p13-p12

Cellular Component: membrane; cytoplasm; endomembrane system; intracellular organelle; cytosol

Molecular Function: protein binding; protein kinase binding

Biological Process: regulation of apoptosis; apoptosis

Research Articles on BCL2L14

Similar Products

Product Notes

The BCL2L14 bcl2l14 (Catalog #AAA1298261) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-327aa; Full Length. The amino acid sequence is listed below: MCSTSGCDLE EIPLDDDDLN TIEFKILAYY TRHHVFKSTP ALFSPKLLRT RSLSQRGLGN CSANESWTEV SWPCRNSQSS EKAINLGKKK SSWKAFFGVV EKEDSQSTPA KVSAQGQRTL EYQDSHSQQW SRCLSNVEQC LEHEAVDPKV ISIANRVAEI VYSWPPPQAT QAGGFKSKEI FVTEGLSFQL QGHVPVASSS KKDEEEQILA KIVELLKYSG DQLERKLKKD KALMGHFQDG LSYSVFKTIT DQVLMGVDPR GESEVKAQGF KAALVIDVTA KLTAIDNHPM NRVLGFGTKY LKENFSPWIQ QHGGWEKILG ISHEEVD. It is sometimes possible for the material contained within the vial of "Apoptosis facilitator Bcl-2-like protein 14 (BCL2L14), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.