Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Apoptosis regulator Bcl-2 (BCL2) Recombinant Protein | BCL2 recombinant protein

Recombinant Chicken Apoptosis regulator Bcl-2 (BCL2)

Gene Names
BCL2; bcl-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apoptosis regulator Bcl-2 (BCL2); Recombinant Chicken Apoptosis regulator Bcl-2 (BCL2); Recombinant Apoptosis regulator Bcl-2 (BCL2); Apoptosis regulator Bcl-2; BCL2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-233
Sequence
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRPPVPPAPAPAAAPAAVAAAGASSHHRPEPPGSAAASEVPPAEGLRPAPPGVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTAHGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIATWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
Sequence Length
232
Species
Gallus gallus (Chicken)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,687 Da
NCBI Official Full Name
apoptosis regulator Bcl-2
NCBI Official Synonym Full Names
B-cell CLL/lymphoma 2
NCBI Official Symbol
BCL2
NCBI Official Synonym Symbols
bcl-2
NCBI Protein Information
apoptosis regulator Bcl-2; PCKBCL2
UniProt Protein Name
Apoptosis regulator Bcl-2
Protein Family
UniProt Gene Name
BCL2
UniProt Synonym Gene Names
BCL-2
UniProt Entry Name
BCL2_CHICK

Uniprot Description

Function: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1).

Subunit structure: Forms homodimers, and heterodimers with BAX, BAD, BAK and Bcl-X(L). Heterodimerization with BAX requires intact BH1 and BH2 motifs, and is necessary for anti-apoptotic activity

By similarity. Also interacts with APAF1 and RAF-1

By similarity.

Subcellular location: Mitochondrion outer membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.

Tissue specificity: In adult chicken expressed, in thymus, spleen, kidney, heart, ovary and brain, with the highest levels in the thymus. In the embryo, highly levels expressed in all tissues with high levels in the bursa of Fabricius.

Domain: The BH4 motif is required for anti-apoptotic activity and for interaction with RAF-1

By similarity.

Sequence similarities: Belongs to the Bcl-2 family.

Sequence caution: The sequence CAA78018.1 differs from that shown. Reason: Frameshift at positions 63 and 82.

Research Articles on BCL2

Similar Products

Product Notes

The BCL2 bcl2 (Catalog #AAA960456) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-233. The amino acid sequence is listed below: MAHPGRRGYD NREIVLKYIH YKLSQRGYDW AAGEDRPPVP PAPAPAAAPA AVAAAGASSH HRPEPPGSAA ASEVPPAEGL RPAPPGVHLA LRQAGDEFSR RYQRDFAQMS GQLHLTPFTA HGRFVAVVEE LFRDGVNWGR IVAFFEFGGV MCVESVNREM SPLVDNIATW MTEYLNRHLH NWIQDNGGWD AFVELYGNSM RPLFDFSWIS LKTILSLVLV GACITLGAYL GHK. It is sometimes possible for the material contained within the vial of "Apoptosis regulator Bcl-2 (BCL2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.