Apoptosis regulator BAX (BAX) Recombinant Protein | BAX recombinant protein

Recombinant Bovine Apoptosis regulator BAX (BAX)

Cat. Num. AAA7010303

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Apoptosis regulator BAX (BAX); Recombinant Bovine Apoptosis regulator BAX (BAX); BAX recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-192aa; Full length protein
• Sequence: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLS ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV LTASLTIWKKMG
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Bovine
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for BAX recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 41386764
• NCBI GeneID: 280730
• NCBI Accession #: NP_776319.1
• NCBI GenBank Nucleotide #: NM_173894.1
• UniProt Accession #: O02703
• Molecular Weight: – Da
• NCBI Official Full Name: apoptosis regulator BAX
• NCBI Official Symbol: BAX
• NCBI Protein Information: apoptosis regulator BAX
• UniProt Protein Name: Apoptosis regulator BAX
• Protein Family: Apoptosis regulator
• UniProt Gene Name: BAX
• UniProt Entry Name: BAX_BOVIN

Uniprot Description

Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis. BAX deficiency leads to lymphoid hyperplasia and male sterility, because of the cessation of sperm production (). Interacts (via a C-terminal 33 residues) with NOL3 (via CARD domain); inhibits BAX activation and translocation and consequently cytochrome c release from mitochondria ().