Membrane-associated ATPase C chain (atpP) Recombinant Protein | ST1439 recombinant protein
Recombinant Sulfolobus tokodaii Membrane-associated ATPase C chain (atpP)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Membrane-associated ATPase C chain (atpP); Recombinant Sulfolobus tokodaii Membrane-associated ATPase C chain (atpP); Recombinant Membrane-associated ATPase C chain (atpP); Membrane-associated ATPase C chain; Sul-ATPase proteolipid chain; ST1439 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-101
Sequence
MKKTWLPFLLLPLLVSATIFSAQAPYDTAQGFEGLNIGAGLAIGLAAIGAGVAVGMAAAAGIGVLTERRDMFGTILIFVAIGEGIAVYGILFAVLMLFGKF
Sequence Length
101
Species
Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
10,362 Da
NCBI Official Full Name
V-type ATP synthase subunit K
NCBI Official Symbol
ST1439
NCBI Protein Information
V-type ATP synthase subunit K
UniProt Protein Name
Membrane-associated ATPase C chain
UniProt Gene Name
atpP
UniProt Entry Name
ATPL_SULTO
Uniprot Description
Function: The C chain is a proteolipid, and one of the membranous subunits of the nonenzymatic component of the Sul-ATPase complex.
Subunit structure: Sul-ATPase is composed of six (or maybe five) subunits: alpha, beta, delta, gamma, C (proteolipid), and possibly epsilon.
Subcellular location: Cell membrane; Multi-pass membrane protein
Potential.
Sequence similarities: Belongs to the V-ATPase proteolipid subunit family.
Caution: Was originally (Ref.1) reported as originating from S.acidocaldarius.
Similar Products
Product Notes
The ST1439 atpp (Catalog #AAA1260553) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-101. The amino acid sequence is listed below: MKKTWLPFLL LPLLVSATIF SAQAPYDTAQ GFEGLNIGAG LAIGLAAIGA GVAVGMAAAA GIGVLTERRD MFGTILIFVA IGEGIAVYGI LFAVLMLFGK F. It is sometimes possible for the material contained within the vial of "Membrane-associated ATPase C chain (atpP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
