Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATPase inhibitor, mitochondrial (Atpif1) Recombinant Protein | Atpif1 recombinant protein

Recombinant Rat ATPase inhibitor, mitochondrial (Atpif1)

Gene Names
Atp5if1; Atpi; IF1PA; Atpif1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATPase inhibitor; mitochondrial (Atpif1); Recombinant Rat ATPase inhibitor; Atpif1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-107, Full length protein
Sequence
GSDSSESMDSGAGSIREAGGAFGKREKAEEDRYFREKTREQLAALKKHHEDEIDHHSKEIERLQKQIERHKKKIKYLKNSEH
Sequence Length
82
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Atpif1 recombinant protein
This gene encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,248 Da
NCBI Official Full Name
ATPase inhibitor, mitochondrial
NCBI Official Synonym Full Names
ATP synthase inhibitory factor subunit 1
NCBI Official Symbol
Atp5if1
NCBI Official Synonym Symbols
Atpi; IF1PA; Atpif1
NCBI Protein Information
ATPase inhibitor, mitochondrial
UniProt Protein Name
ATPase inhibitor, mitochondrial
Protein Family
UniProt Gene Name
Atpif1
UniProt Synonym Gene Names
Atpi; If1; IF(1); IF1

NCBI Description

inhibits ATP hydrolysis catalyzed by the mitochondrial ATP synthase/ATPase complex [RGD, Feb 2006]

Uniprot Description

Endogenous F1F(o)-ATPase inhibitor limiting ATP depletion when the mitochondrial membrane potential falls below a threshold and the F1F(o)-ATP synthase starts hydrolyzing ATP to pump protons out of the mitochondrial matrix. Required to avoid the consumption of cellular ATP when the F1F(o)-ATP synthase enzyme acts as an ATP hydrolase. Indirectly acts as a regulator of heme synthesis in erythroid tissues: regulates heme synthesis by modulating the mitochondrial pH and redox potential, allowing FECH to efficiently catalyze the incorporation of iron into protoporphyrin IX to produce heme ().

Research Articles on Atpif1

Similar Products

Product Notes

The Atpif1 atpif1 (Catalog #AAA717692) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-107, Full length protein. The amino acid sequence is listed below: GSDSSESMDS GAGSIREAGG AFGKREKAEE DRYFREKTRE QLAALKKHHE DEIDHHSKEI ERLQKQIERH KKKIKYLKNS EH. It is sometimes possible for the material contained within the vial of "ATPase inhibitor, mitochondrial (Atpif1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.