ATPase inhibitor, mitochondrial (ATPIF1) Recombinant Protein | ATPIF1 recombinant protein

Recombinant Human ATPase inhibitor, mitochondrial (ATPIF1)

Cat. Num. AAA1310036

• Gene Names: ATP5IF1; IP; ATPI; ATPIP; ATPIF1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ATPase inhibitor; mitochondrial (ATPIF1); Recombinant Human ATPase inhibitor; ATPIF1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 26-106, Full length protein
• Sequence: GSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD
• Sequence Length: 81

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for ATPIF1 recombinant protein

This gene encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified.

NCBI and Uniprot Product Information

• NCBI GI #: 7705927
• NCBI GeneID: 93974
• NCBI Accession #: NP_057395.1
• NCBI GenBank Nucleotide #: NM_016311.4
• UniProt Accession #: Q9UII2; Q5JXL8; Q6IAQ7; Q9BSL9
• Molecular Weight: 6,592 Da
• NCBI Official Full Name: ATPase inhibitor, mitochondrial isoform 1
• NCBI Official Synonym Full Names: ATP synthase inhibitory factor subunit 1
• NCBI Official Symbol: ATP5IF1
• NCBI Official Synonym Symbols: IP; ATPI; ATPIP; ATPIF1
• NCBI Protein Information: ATPase inhibitor, mitochondrial
• UniProt Protein Name: ATPase inhibitor, mitochondrial
• Protein Family: ATPase inhibitor
• UniProt Gene Name: ATPIF1
• UniProt Synonym Gene Names: ATPI; IF(1); IF1

NCBI Description

This gene encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

Endogenous F1F(o)-ATPase inhibitor limiting ATP depletion when the mitochondrial membrane potential falls below a threshold and the F1F(o)-ATP synthase starts hydrolyzing ATP to pump protons out of the mitochondrial matrix. Required to avoid the consumption of cellular ATP when the F1F(o)-ATP synthase enzyme acts as an ATP hydrolase. Indirectly acts as a regulator of heme synthesis in erythroid tissues: regulates heme synthesis by modulating the mitochondrial pH and redox potential, allowing FECH to efficiently catalyze the incorporation of iron into protoporphyrin IX to produce heme.