V-type ATP synthase subunit I (atpI) Recombinant Protein | atpI recombinant protein
Recombinant Methanocaldococcus jannaschii V-type ATP synthase subunit I (atpI)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
V-type ATP synthase subunit I (atpI); Recombinant Methanocaldococcus jannaschii V-type ATP synthase subunit I (atpI); atpI recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-695aa; full length protein
Sequence
MILVRPVRMKKLKAVILDEKIDNVVRSLHEEGIVELCDLSEKLEDLEWKTLLSPSSSADY VRNVTSLMIKAGRILDMFSSVSQKETSIKDILNPKPVEKKKVSFNSYQEVIDYAEKVLNE ISKEVDGPAERLSELDNKKSKLLQLKEQISYLKGLEFDLKYLGSGEYVFIGAGSVPKEKL GELKAELDKVADGYIGIFSGSEFEKDKKIRVPIVFVTLKEKLENVLSEIRKFEFERYDIS DVEGTPSEALSKIESELKAIESERNSLIEKLKALAQKWEKELLAVYELLSIEKARGDAYS QFGKTDRTYYIEAWVPARDAEKAKSLIENSADGFAFVEITEPDEPEEKIPVLLDNPKVIK PFEMLTEMYALPKYNEVDPTLLLVPGFLLFYGIMLTDAVYGLLLTIIGLFIWKKIGKVSE GANKLGYILTLAGISTVIMGIITGGYLGDFTYEFFGFDVTKTPLALVNPLGESYYINNNN PLFTLGSISVTNGPMAILVFSIFVGLIHLLIGLFVGFKENVKRGNMGDAFINQGVWILLI LSIFVGIGLMFAGANTMIAGGIIGIFVVLAILASMYKGYKSGGVMEAILGAMDVTGFLGN VLSYARLLALCLATGGLAMAVNIMAKLVGESIPVIGIIVAIIILLVGHTFNFVMNGLGAF IHSLRLHYVEFFSQFYEGGGKKFSPFKANREYTTA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for atpI recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
76,954 Da
NCBI Official Full Name
V-type ATP synthase subunit I
UniProt Protein Name
V-type ATP synthase subunit I
Protein Family
UniProt Gene Name
atpI
UniProt Entry Name
VATI_METJA
Uniprot Description
Produces ATP from ADP in the presence of a proton gradient across the membrane.
Similar Products
Product Notes
The atpI atpi (Catalog #AAA7010191) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-695aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the atpI atpi for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MILVRPVRMK KLKAVILDEK IDNVVRSLHE EGIVELCDLS EKLEDLEWKT LLSPSSSADY VRNVTSLMIK AGRILDMFSS VSQKETSIKD ILNPKPVEKK KVSFNSYQEV IDYAEKVLNE ISKEVDGPAE RLSELDNKKS KLLQLKEQIS YLKGLEFDLK YLGSGEYVFI GAGSVPKEKL GELKAELDKV ADGYIGIFSG SEFEKDKKIR VPIVFVTLKE KLENVLSEIR KFEFERYDIS DVEGTPSEAL SKIESELKAI ESERNSLIEK LKALAQKWEK ELLAVYELLS IEKARGDAYS QFGKTDRTYY IEAWVPARDA EKAKSLIENS ADGFAFVEIT EPDEPEEKIP VLLDNPKVIK PFEMLTEMYA LPKYNEVDPT LLLVPGFLLF YGIMLTDAVY GLLLTIIGLF IWKKIGKVSE GANKLGYILT LAGISTVIMG IITGGYLGDF TYEFFGFDVT KTPLALVNPL GESYYINNNN PLFTLGSISV TNGPMAILVF SIFVGLIHLL IGLFVGFKEN VKRGNMGDAF INQGVWILLI LSIFVGIGLM FAGANTMIAG GIIGIFVVLA ILASMYKGYK SGGVMEAILG AMDVTGFLGN VLSYARLLAL CLATGGLAMA VNIMAKLVGE SIPVIGIIVA IIILLVGHTF NFVMNGLGAF IHSLRLHYVE FFSQFYEGGG KKFSPFKANR EYTTA. It is sometimes possible for the material contained within the vial of "V-type ATP synthase subunit I (atpI), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
