Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP synthase subunit b, chloroplastic (atpF) Recombinant Protein | atpF recombinant protein

Recombinant Barbarea verna ATP synthase subunit b, chloroplastic (atpF)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP synthase subunit b; chloroplastic (atpF); Recombinant Barbarea verna ATP synthase subunit b; Recombinant ATP synthase subunit b; chloroplastic; ATP synthase F(0) sector subunit b ATPase subunit I; atpF recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-184
Sequence
MKNLTDSFVYLGHWPSAGSFGFNTDILATNPINLSVVFGVLIFFGKGVLNDLLDNRKQRILNTIRNSEELREGAIQQLENARARLRKVETEADQFRVNGYSEIEREKLNLINSTYKTLKQLENYKNETILFEQQRTINQVRERVFQQALQGAIGTLNSCLSHELHLRTINANIGMFGTMKEITD
Sequence Length
184
Species
Barbarea verna (Land cress) (Early yellowrocket)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,094 Da
NCBI Official Full Name
ATPase I subunit
NCBI Official Symbol
atpF
NCBI Protein Information
ATP synthase CF0 B subunit
UniProt Protein Name
ATP synthase subunit b, chloroplastic
Protein Family
UniProt Gene Name
atpF
UniProt Entry Name
ATPF_BARVE

Uniprot Description

Function: F1F0 ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F1 containing the extramembraneous catalytic core and F0 containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation

By similarity. HAMAP-Rule MF_01398Component of the F0 channel, it forms part of the peripheral stalk, linking F1 to F0

By similarity. HAMAP-Rule MF_01398

Subunit structure: F-type ATPases have 2 components, F1 - the catalytic core - and F0 - the membrane proton channel. F1 has five subunits: alpha3, beta3, gamma1, delta1, epsilon1. F0 has four main subunits: a1, b1, b'1 and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F1 is attached to F0 by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta, b and b' chains

By similarity.

Subcellular location: Plastid › chloroplast thylakoid membrane; Single-pass membrane protein

By similarity HAMAP-Rule MF_01398.

Miscellaneous: In plastids the F-type ATPase is also known as CF1CF0. HAMAP-Rule MF_01398

Sequence similarities: Belongs to the ATPase B chain family.

Similar Products

Product Notes

The atpF atpf (Catalog #AAA1167016) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-184. The amino acid sequence is listed below: MKNLTDSFVY LGHWPSAGSF GFNTDILATN PINLSVVFGV LIFFGKGVLN DLLDNRKQRI LNTIRNSEEL REGAIQQLEN ARARLRKVET EADQFRVNGY SEIEREKLNL INSTYKTLKQ LENYKNETIL FEQQRTINQV RERVFQQALQ GAIGTLNSCL SHELHLRTIN ANIGMFGTMK EITD. It is sometimes possible for the material contained within the vial of "ATP synthase subunit b, chloroplastic (atpF), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.