ATP synthase subunit a (atpB) Recombinant Protein | atpB recombinant protein

Recombinant Escherichia coli ATP synthase subunit a (atpB)

• Gene Names: atpB; ECK3731; JW3716; papD; uncB
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ATP synthase subunit a (atpB); Recombinant Escherichia coli ATP synthase subunit a (atpB); Recombinant ATP synthase subunit a (atpB); ATP synthase subunit a; ATP synthase F0 sector subunit a F-ATPase subunit 6; atpB recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-271
• Sequence: MASENMTPQDYIGHHLNNLQLDLRTFSLVDPQNPPATFWTINIDSMFFSVVLGLLFLVLFRSVAKKATSGVPGKFQTAIELVIGFVNGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMALGVFILILFYSIKMKGIGGFTKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH
• Sequence Length: 271

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 16131606
• NCBI GeneID: 948252
• NCBI Accession #: NP_418194.1
• NCBI GenBank Nucleotide #: NC_000913.2
• UniProt Accession #: P0AB98; P00855; Q2M856; Q47065; Q47708
• Molecular Weight: 30,303 Da
• NCBI Official Full Name: F0 sector of membrane-bound ATP synthase, subunit a
• NCBI Official Symbol: atpB
• NCBI Official Synonym Symbols: ECK3731; JW3716; papD; uncB
• NCBI Protein Information: F0 sector of membrane-bound ATP synthase, subunit a
• UniProt Protein Name: ATP synthase subunit a
• Protein Family: ATP synthase
• UniProt Gene Name: atpB
• UniProt Synonym Gene Names: papD; uncB
• UniProt Entry Name: ATP6_ECOLI

NCBI Description

The a subunit of the F0 complex plays a critical role in the proton translocation mechanism . [More information is available at EcoCyc: EG10099].

Uniprot Description

Function: Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane. HAMAP-Rule MF_01393

Subunit structure: F-type ATPases have 2 components, CF1 - the catalytic core - and CF0 - the membrane proton channel. CF1 has five subunits: alpha3, beta3, gamma1, delta1, epsilon1. CF0 has three main subunits: a1, b2 and c(9-12). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. CF1 is attached to CF0 by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains.

Subcellular location: Cell inner membrane; Multi-pass membrane protein Ref.19.

Sequence similarities: Belongs to the ATPase A chain family.

Caution: Was originally (Ref.3) proposed to be encoded from either Met-1 or Val-71 (PID CAA23521); it is now thought to start of Met-1.