ATP synthase subunit a (atpB) Recombinant Protein | atpB recombinant protein
Recombinant Mycobacterium marinum ATP synthase subunit a (atpB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP synthase subunit a (atpB); Recombinant Mycobacterium marinum ATP synthase subunit a (atpB); atpB recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-250aa; full length protein
Sequence
MTESILAAQIEVGEHHTATWLGMTVNTDTVLSTAIAALIVLALAFYLRSKVTSTAVPGGV QLFFEAITIQMRGQVESAIGMRIAPFVLPLAVTIFVFILISNWLSVLPVQYTDEHGQTTE LLKPAAADINYVLALALFVFVCYHAAGIWRRGIVGHPIKLLKGHVAILAPINLVEEIAKP ISLSLRLFGNIFAGGILVALIALFPPYIMWAPNAIWKSFDLFVGAIQAFIFALLTILYFS QAMELEEDHH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mycobacterium marinum (strain ATCC BAA-535 / M)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for atpB recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,355 Da
NCBI Official Full Name
MULTISPECIES: ATP synthase subunit A
UniProt Protein Name
ATP synthase subunit a
Protein Family
UniProt Gene Name
atpB
UniProt Entry Name
ATP6_MYCMM
Uniprot Description
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Similar Products
Product Notes
The atpB atpb (Catalog #AAA7008792) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-250aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the atpB atpb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTESILAAQI EVGEHHTATW LGMTVNTDTV LSTAIAALIV LALAFYLRSK VTSTAVPGGV QLFFEAITIQ MRGQVESAIG MRIAPFVLPL AVTIFVFILI SNWLSVLPVQ YTDEHGQTTE LLKPAAADIN YVLALALFVF VCYHAAGIWR RGIVGHPIKL LKGHVAILAP INLVEEIAKP ISLSLRLFGN IFAGGILVAL IALFPPYIMW APNAIWKSFD LFVGAIQAFI FALLTILYFS QAMELEEDHH. It is sometimes possible for the material contained within the vial of "ATP synthase subunit a (atpB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
