Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP synthase subunit s, mitochondrial (ATP5S) Recombinant Protein | ATP5S recombinant protein

Recombinant Bovine ATP synthase subunit s, mitochondrial (ATP5S)

Gene Names
ATP5S; FB
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP synthase subunit s; mitochondrial (ATP5S); Recombinant Bovine ATP synthase subunit s; ATP5S recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-200, Full length protein
Sequence
FWGWLNAVFNKVDHDRIRDVGPDRAASEWLLRCGAMVRYHGQQRWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLQYVEKIRLCKCHYIEDGCLERLSQLENLQKSMLEMEIISCGNVTDKGIIALHHFRNLKYLFLSDLPGVKEKEKIVQAFKTSLPSLELKLDLK
Sequence Length
175
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ATP5S recombinant protein
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. This gene encodes the subunit s, also known as factor B, of the proton channel. This subunit is necessary for the energy transduction activity of the ATP synthase complexes. Alternatively spliced transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,293 Da
NCBI Official Full Name
ATP synthase subunit s, mitochondrial
NCBI Official Symbol
ATP5S
NCBI Official Synonym Symbols
FB
NCBI Protein Information
ATP synthase subunit s, mitochondrial
UniProt Protein Name
ATP synthase subunit s, mitochondrial
Protein Family
UniProt Gene Name
ATP5S
UniProt Synonym Gene Names
ATPW; FB

Uniprot Description

Involved in regulation of mitochondrial membrane ATP synthase. Necessary for H+ conduction of ATP synthase. Facilitates energy-driven catalysis of ATP synthesis by blocking a proton leak through an alternative proton exit pathway.

Research Articles on ATP5S

Similar Products

Product Notes

The ATP5S atp5s (Catalog #AAA948257) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-200, Full length protein. The amino acid sequence is listed below: FWGWLNAVFN KVDHDRIRDV GPDRAASEWL LRCGAMVRYH GQQRWQKDYN HLPTGPLDKY KIQAIDATDS CIMSIGFDHM EGLQYVEKIR LCKCHYIEDG CLERLSQLEN LQKSMLEMEI ISCGNVTDKG IIALHHFRNL KYLFLSDLPG VKEKEKIVQA FKTSLPSLEL KLDLK. It is sometimes possible for the material contained within the vial of "ATP synthase subunit s, mitochondrial (ATP5S), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.