ATP synthase lipid-binding protein, mitochondrial (Atp5g2) Recombinant Protein | Atp5g2 recombinant protein

Recombinant Mouse ATP synthase lipid-binding protein, mitochondrial (Atp5g2)

• Gene Names: Atp5g2; 1810041M08Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ATP synthase lipid-binding protein; mitochondrial (Atp5g2); Recombinant Mouse ATP synthase lipid-binding protein; Recombinant ATP synthase lipid-binding protein; mitochondrial; ATP synthase proteolipid P2 ATPase protein 9 ATPase subunit c; Atp5g2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 72-146
• Sequence: DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
• Sequence Length: 146

• Species: Mus musculus (Mouse)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 13385960
• NCBI GeneID: 67942
• NCBI Accession #: NP_080744.1
• NCBI GenBank Nucleotide #: NM_026468.2
• UniProt Accession #: P56383; Q3KQM0; Q9CQ23
• Molecular Weight: 15,476 Da
• NCBI Official Full Name: ATP synthase lipid-binding protein, mitochondrial
• NCBI Official Synonym Full Names: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9)
• NCBI Official Symbol: Atp5g2
• NCBI Official Synonym Symbols: 1810041M08Rik
• NCBI Protein Information: ATP synthase lipid-binding protein, mitochondrial; ATPase protein 9; ATPase subunit c; ATP synthase proteolipid P2; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2
• UniProt Protein Name: ATP synthase lipid-binding protein, mitochondrial
• UniProt Gene Name: Atp5g2
• UniProt Entry Name: AT5G2_MOUSE

Uniprot Description

ATP5G2: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element. Belongs to the ATPase C chain family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Cellular Component: mitochondrion